ELF4Ԫ4 (444ԀԀhhhhh ԗ''/lib/ld-linux.so.1el)-8<6W4{W,(AA'?5Y%s4Ca[ K&^dv d<1Sk ]+i1u.<JhgcUU CWON+2qI  2' &w!`6X7i:}w\e+rpV[kE{Qk#z{h0iNKx1~_WAZEc +%_6D?:,=# & ^pIJ7}h lF8SD hS3>@%G!C@Vl,ob ,,6fd3.=^v[HumbCd7|(aut$a~gM}zOeTN#"NRP=n!DOQzy/4m |?x b" y$@2jO8P>dyS!c.ccXj*UZi8 ]hixHITz;: 6j]Fj  Gv*`[)A*-`<.qr: T?MY=tn=A<B_`OxTw>1ftX5!<HR/cD" {O\L9hJt6WnHVr*&IQP%u(]kI sEfnl(C@'v5J{ {c$gq&y__3h3~4[r `\+M?\,U} ~9R3{8x PRqBzXGpa lm'PCGpgV9BL']^MbHmlP V3<R)5^oFP{wzUonkZDb*0|v`NaK1l;?!\/YP0fIyXMj$6-'nw9+9-d-rB.FVm pU`O1\Q<E],p(INW7L>?p9^UHEY,4#swPKI:DX22tmw )/QSf=Qes8 ivr;Kb  NX9&[MkLU ON5fVpI;'!Yk%Z5cq_s=n|jj)YG{mV"H>JtBo!kbQqLAgY+za}.G]# :4\p% \Rf-Kx;afLE:*~ (y|.(~7qA}~##v[XXH}`nK-0#DT K[kB2diA@DJt$$~x 4=jW1yvBv}u"78* "jo#BZd/0r/Tz(o s]`sWbri yisJZ3GQcMD>RF)~S1_eHUR|e[4h]65*) n3>/>1Ee4S 0;$WFaS0OE< :B.t=, @o|9 -QF'0:C%e^65J L%}3u(>'Jm*Zz$)_wb^Y5Zu;-g\VG@g7_7 TLu& Z yAex@qE/MmM;r+g2CaR$"|Nfd)8%""t7 ^;g l8Ku!qTS9|oYC2G?T/lw?h.s&L&xF02+Fo@ '`%+U"2h"7"=""E"M"^dp, jt(!ph zh4p( *)mh! :TH"xmm"""H""""h" "(("/"6h">"H"U"\"b"g"m8"s"x("}"h"("x"""H"H""""8"x"""H9"]"X>* H<A ^"%g,3#<CgJRZ"aiX~o}v&~D"h(>(fIA28XGJl(hh< Z!4)X1(8?9"GH"SC"Zx&"d()!pX^"w^"^"x^"o"8V"xf"f"(o"8^"x""X4"xXHH(T^"W"#X&"+C"2H"9s"?8g"EX&"LH("S\a9ky(hXC-HKx(T8Vw")T(f"{"xu"x&" hy"8T"e" g"(8`".G5g?lEtN8"VhFb*kq{xqb ()t(h,l(l(|0 l @)  v U  0o x V  p'  $.  >  F J `J m   `  P       sK ;`  ;; p w 6   M  h  ,  K U dp  q: {`< ` P n g `a   P   S    [  4P  #) .@  4a F % Ro fI< p0  zI p  0 p  !  E P !  G @   `  l  @ ' ?` 5 { B w Q `  b p  { *= 8   P 4 A  `   U O    x # + 0 О % C  Q P  f @ q    ! )  0 ) @ C `U Q;  Y    p.   0E   & @Qb 6  A { W z h p  w `  \ %  @ 0 \ y} ` `7i  4    4" ] * t( 7  C  * U `  c ml w  C ) ]  в j Ё   +   P `2  p+  4$ `  2  G ` V P d d o   X f Д F D4 0 % S Ac   x4  y   # , : 7:  HY 3 X@ ` i op ~  b  xI >   {    :   |    D '{  < " EP  OR? [`  fD x @B @8         O 8  0  pgp  a  .` 7r Kp  U  f 3 y.8 }Pm O ^  | N .  0   Q    ; l | jM L  @t 4 '  1 = LPt Q  Z@+L m4t  0  { $!  V 8 `T|  Э k @Q i  % 10 ? L> $ [0 k u  }|  . S  8 P+   0 X 8 ! `Q   p9   + - 7CU RPP  `P r  | @3    x   9 r   I  Lk ! @V C  # 0&  3pv  :p H W , i=  v  Њ Y   @7  A   8| 4   ` C    ЉF  Ф  @ u % 2p1 B B`Z  l wPM T   { p _  d ps A k    @  k  ! -2  8 = B m UPB . eW o  |     @ O   pp  `;n `   _ (+8  4 J~3 V@ : ^ P f   # @ c   T| 0 `     t p  p0  K |  #@) 10  7!9 A < N@& gp ^ yc  >  =   WL С  p 0 g E  c % 1\  ?a P + V@0 m4t@| Q P X er  ( @s    ` m  ( 8  $ %     ! ) v  0 P A0 ( N , b% A }`K | `@ =  j M+ U    ]& @ & >  ~ S #a! .p) ^ =` t EZ Kpiy ZH o<    ) x  0  6 [ # { @ ,  ' 2 - ` : I(| R  a w n    7 p   @  4 @%  p    `  A  H ) R 5D| =  O@F \G l j } :[ H4]   A    p    !E 1  :  EJ  P R [ i A  u  H f@ @    0  $7    ; (   (h 90 3 M  ^`z, g. x-  P` ) %q   A @   $ /  $ L| / { 8 J  ` Gf q  z    N P І" 2 0G  P S  $  !  !!@ .!P w =! L! % _!@| i! q! k !  !J% !, !x  !| !{ !  !D !9w !  !pV  !  "JN "P  "#"L 2" 4 ;"Pc F" O" , h"r |" "@G " e "P g "X "d  "  "h  "  "  #0 #0  0#`^ @#`  J#+  X#  e#K   m#B q#_ }#$ #Q #w #P Q # #P #  # # #0 ` $p& $  $Nr '$? n 8$8 . B$P  ^$x + s$T $04  $k $P < $pu $ = $ $0 L $  $@  % h %hM ,%h( 7%  I%@FJ [%p w h%$| q%|  %X  %м@ %`T I %@A $ %\j % %  & &` &,  7&) J&  W&  c&% 5 u&&&@ f &Q&@  &) & @ & < & & & X &T &  'KS '  ,'  G' 7 Q'|4Y'g'  v'0  ' '4 'C * ' l ' 'p } '@U ' 'at '  'p ' '0f  ({ ( $(  .(@ 4(;( L(о  ](P  f(p 4 w( " ($ ( (0 ( ( v (` (PS (( (? )$ )# )@  -) ?)`q  I)0 R T) r \)Pr6 o) ! |)Pa );  )  )) )  )L )| )@g )))@ 4 * * . *}Y /* ;*  C*@# ` S*l a*| H s* * * * *r t *p F *Џ *  * G +x  +  !+`   ,+0A 7+!, G+q i U+  i+  + +v +`1 +F{ +d + ~ + + d +@0 , , !, e /,p*  B,  O,]  `, 7 u,K ' , , ,- ,`  ,p?  , , |  ,E ,L ,` / , K -p  %-P 0- M M-p ~ [-@  i-X w-p  ~-  -p 6 -P i - -0 - Q -4 - b -`K . F .P $.P  3.  >.`' % U., d.p;  u.S . V .P{ .I . .. ^ .@>  ..f  .l .  /` "/p? 5/XF/@ R/l a/G n/ < b {/0 / /  /0` /p / /`d / d /@ d 0`  0p 0p (0{ 30p2 2 A0 S0k \0 @ q0 [ 0pu 0 0H| 0 7  0   0E 0@  0P 07  0G  0| 1p 1p  )1401{ >1 D1  S1J r e1@ s14z1 | 1Pz 1 1  1P 1x 1i< 10.  1P s 142н \ !2D 02к\ ?20q . F2 P2 \2  u2}2qP 2+ 2` p 2`( 2 0 2p7 2Jq 2B 2p  30 @ 3E !3Cd -3  <3@ [ I3|( T3v \3 " g3# u3~ }33p ) 3\ 3{ 3 3h   3 3  3 3`=  3`  3pZ" 3@J i 4  4V '4 f .4_  C4  _40  r4b  |4 45 4@z ^ 4 ? 4:@ 4P. M 44 A , 4 ^ 5$ 5B 5p n 150< >5  M5  V5І[ d5p d {5 / 5P 5L45{ 545M 5%. 5pP  5[ 5@$ 5 m 5P  6{ 6 "65 /6p  A64H6 ' U60 a64h6r67  ~6pk 6< 6  6|I 6 6p < 6`Cl 60K 6 7`  7^ 7p  47@_ ?7(M7Y U7 I  d7`c m7 {7T 7p  7; ) 747Pk  7(T 7w l 7  7N 7  7P l 8>x 88 C %8& 28: =8  I8_ V8Ks i8* v8 x 8 8ЙB 8> 8  8P48 8# 8p> 8  8 6 80> 9  9M 9`W  )9 092 <9p E9 U9 } h9 0 w9P.  9  9P+ 94 98J 99@ " 9{ 9 q 9J :K  :` ) :b   ,:4 <: F:4N:  _:@ A i:ЍXv: 6 |:@!1 :  :  :z :{ :P  :  :` :P   :P: :P  :?  ;P ;0; r D; P;  Z; b;d  n;Л I ; ;A ; ;6 < ;4 ; >  ; ; ; & <  <0(<  7< A<`  N<Pm& _< l<p {<? C <  <  <@ V <` <@>  </ < <W < <  =P # = O %=p}  9=u 4 I= Y=HI f=_z t=x{ =P =0 =[  =qr =п | =`P =0 ==py =8 _ > [ >O $>0E /> >>  G> ]>5K k>4 q>  {>0 g >> >0L >`:  >ЫI >  > | >*> >p \ >{ ?  !? +?   5?   D?Д N?3 x ^? D o?  ?  ?\B ?`  ?\  ? H ?` f ?  ?; ! ?hI @`1 @ " 6@` y L@/ a@ t@7  @c  @ @ > @`\ @ ' @ o @ @ O @<  @ A  A+9 ,A- 7A4=A0% GA0 C cAx[ tA X |Ap A]  A3 ? A  Ap A{ Ak A  A A6  Am B  B$B +B DB J SB _ ZB  dBPZ xB0w < ~B B!" Bh BO B .  B B T BM < BO B`& CL C ,C@  9C) DC| NCp \C= gC(jC? tC D C! C? A C Z C1 Clu C C Z C I Cp@ D| D  D ,D,/Dp4o =D0@D4CD RD : fD  oD0( zD N Da D D  D0& D` D`~8 D@ D@ D0, E  E E  $E~  5EM| FE VEiE_ qE yE Ex E*  EY Ep} / E?  E EP;  E o Fm) F a F % Fo _ *F@T 9 :F> IF 7 UFpzE `F qFP, x ~F4F 6 F S F8F$ F ) F 4F-  FФ  F  Fr  FG Gl G= Gpz  +Gv >G -  TGy& `GrGT Gl( G 5 G7  G^ Ge G  G 1 G0z G  Hh H 'H<9Hp Z PH`OZ bH|2 pHd  H@r H  H`(  H` H  H Hd N H H  I0) I  IA   )IГ @ 1I  ?Ip 9 PI`l  ZI Z iI x pIw  I= I Ih I D Ih IIJ  Io I@Xd I; W J`F l JJh #J{ /J m 9J ? JJ  TJ cJz \ zJl J * J  J 3 Jp k JT4J y J $ J J J`1 K t K@& 'K@ ? 7K0 . LKp0J ^Kpz f gK`8  tK< K` K }  K p K  K@ KI K~  KZ K LOo LC $L ,L  8L GLČ VL\ cLj nL h {L! L" b L  LI  L LP L  L  L4LB M@G M0 M@Mb# M 3 +M p 8M / FM`3 OMo YM0| bMm  gM pM4wM  M M ( M4| M MP  M}  M * NP NP   Ns ,N  GN Y QN( _N  pN N  N ` N0 NП C N` N 6 N _ N N@ a Oj  Ot %O .Opw W =O,| FO> TOl? ]O@\ rO, O`7  O`  O W OS O{ O  O7h O0( O` OjJ O`  P PD"Pp ,P  7PPk EPu I MP`  ]P@V jP`_Y sP` 4 yP PH P x Ppy P! P` P P`c` P( P@ v PЬ Qh Q0{ @ 'QZ X Z= Z@F Z Z@ 0 Z@r Z  [ [5 %[0 l 8[0  B[  J[ Z[ 3 m[  }[pL X [W [ 7 [y  [ T [  [ L [pM  [  \  \R   )\G 7\ 8 L\ o T\ m h\c  s\ \{ \I  \v < \0^ \pW \@ \X4\ \ \  \ ]P ] 8  ]P> (]' 2]y ~ D] 7 S] P f] A r]   ]# ]Pk ]  ]0x  ]0J$ ]Pv ]t  ], ]p 1 ^`D ^px $^` @ 8^ E^ w Z^P  d^ r^P~^  ^ ^0 ^ ^l D ^ K ^0  ^F ^p 2 ^@=  _{ H _ j (_ ~ 5_1E @_o  E_c  X_`x ! n_ 4 _ _P _E _;  _{ _L _PxB _Ga _p _J d `  `y %` 3 1`  ;`@I G`  `` $ l`6 z`4`  `y `` ] ` `P a `=`P # `  `0}W `P * `3`lR a" @ aB (a d 7 HdlUd  \d`] od@s zd> d=  d H d; dT 9 d  d :> d@ d d*  e e .eT ?e Je@ \e@  feРV qed xe(  eL e   ephS ep ` e e$ e ep) e0i f{| fK  ftH *f0r 7fШ  Kf B  Tf if`> $ wf8  f @ f0 f c f@  f0  f O f f<| f> gXI g @ = "gx( .gPu ? 9g~b Og t  Vg@  dgP rg  g2  gy  gy g  g c g gO g g g 7 h0  "hPq .h?o 8h $ Ih x  Qh{ ah`  ph h  hp \ hW h P hM  h  h hЦ h0h4 ha h`((h@ i  iP7 i (i<  2i  Fi{ Ni  Ui  ei3  i@. i t iP il Y iplw i@[ iE" io i  j0s j+  !jP H 2j 5jM   Dj0{  Rji ^jy bjr hj h wjQ  jP, j  jj L j@ a j j  j x j j6 kpk +k@ < ;k ] ?k` C Vk + ^kл  tkP }k > k kpR kPD k]O k( kб C k F k) l<  lm7  lp * lp !l  2lPe  Al@y Kl`E Xl plf zl@} lP  l j l` F lQ l, l E l@ l0! m! m  m -mL  AmV Nm0:I `m/  umP*s zm m(4m m  m | m@ m\m`  m$ m@ u mL  n n# n  /n  In !  ]n`YO knPO {n Q n  n  n9  nl np ! np i n  np  o0  o=  o +o :o)m Co G Vo6  ao  mo{ |o\op oP% o@7 Y o= oo0l oD o o01 o H pb p .pP L :p0 Ep k Qp0 WpY jp? vp8  ptp  p p0 p & p>  pP p K p Y qH q@r q  /q0Y =qp  Jq@.  Zq! cq@I mq |qb q qp=  q q  qo q@{  q r0  r# E rx&r ,r~ 4r Er!) Qr8 ^rP  irp " urP rT r( r0? rY r~ ] r r  r0q r\4s> s~  )s ] 4s Ds  bsp S ns0 }s` S s0 sj s, k s@K sL>  s( : s s( tt{ t0 B t A 2tm} At Ith 8 Tt n ft pt{ }tp P t  tP* t` ' t X ttD t t2  uc7 u M N u 5u  ?uq@ HuB UuJ  bu vu z uPI u upPR u u u  uR u ^ u i v0 v; )v 3v % =v:j Kv  Xv av  mv` 9 sv4I v   v L vv P v v vP+ libdl.so.1_DYNAMIC_GLOBAL_OFFSET_TABLE_mallocfreedlsymdlclosedlerrordlopenlibm.so.5_init_finierrno__environatexitlibc.so.5__ctype_b__ctype_tolower__ctype_toupper_xstatenvironkillpgsignalwaitpid_lxstat_fxstataccesschdirchmodclosedup2fchmodfcntlforkvforkgeteuidgetgidgetpidgetppidgetrusagegettimeofdaygetuidioctlkilllseekmkdiropenpipereadreadlinkrmdirsetgidsetsidsetuidumaskunameunlinkwritealarmgetpgrprenametimegetpgidselectsigaction__setfpucw__fpu_controlmemcpysetenvstrcmpbindgetenvgetcwdstrerrorstrcpystrchrstrrchrmemmovecallocstrncpyexeclexecvpstrncmpsleepsystem_exittcgetpgrptcsetattrmemsetsigaddsetsigemptysetsrand__strtod_internal__strtol_internalqsortrand__strtoul_internalstrcasecmpstrncasecmpstrncatstrpbrkstrtokstrspnreallocgethostnameisattytcgetattrsys_siglistacceptconnectgetpeernamegetsocknamegetsockoptlistenrecvsendsetsockoptsocketclosediropendirttynamereaddirstrcatstrcspnstrstrabortcrypt_IO_stderr_fprintffflushsprintfrewindfclosefopenfgetsfdopenprintfgethostbynameinet_addrgethostbyaddrgetservbynamegetservbyportinet_atoninet_ntoasnprintfgetpwnamfileno_IO_stdout_getpwuidexitfeoffread_IO_stdin_ftellfwriteputssscanfvsprintffgetcfputcfreopenfseektmpnamvsnprintfctimeendpwentsysconf__libc_inittimezonetzsetlocaltimegmtimestrftime_sys_siglist_errno_etext_edata__bss_start_enddecodeinfounbind_channelfunction_annoyhandle_nickfloodreadlogTcl_DeleteInterpTcl_GetStdChannelirclog_fpunhold_a_windowtcl_sayrecalculate_window_cursorTcl_FreeFileircop_str_to_flagsdo_nslookupreal_notify_leveldo_dirlasttypeTcl_GetChanneldcc_close_type_nick_allmsg_diearray_lookupremove_split_servermeta8_charTcl_ScanCmdsavelistsTcl_StringCmdwill_catch_continue_exceptionsget_window_bound_channelfind_in_listtcl_timerfile_writeserv_statserversaymasskickhandle_dcc_chatget_variableTcl_Mergeadd_channel_grepfunction_cooltcl_flushmodeMatchingBracketlast_sent_noticeH_sentsayfile_validcycleTcl_RecordAndEvalshow_whowasdone_init_functionsdcc_typesterm_initdeadlistadd_to_whosplitin_bufferdll_variableerror_not_oppedTcl_TranslateFileNamedo_screensset_funny_flagscheck_on_hookblesscmdwhoreplyGetLineStackctcp_unquote_itcheck_tcl_msgempty_stringcheck_dcc_listmove_to_abs_wordclear_nicklist_hashtabletcl_putloglevparse_textinvite_dcc_chatTclGetUserHomeTclGetDefaultStdChannelflush_serversend_to_serverreal_lastlog_levelcompress_modesnumeric_dlllast_sent_msgTcl_TraceVarwhois_ignore_wallsTcl_FormatCmdupdate_window_statusTcl_ConcatExecuteTimersscripting_commandTcl_ScanElementmapcwhocharcountstrextload_scriptsfuckemTcl_SocketCmdunsplitwbreak_exceptionbeep_on_levelinput_msgreplye_topicload_depthdelay_flush_allsave_hooksread_and_parse_serverset_process_bitsstart_memdebugget_current_channel_by_refnumis_window_name_uniquebuild_statustcl_cparsetgetnumget_visible_by_refnumexec_cmdtand_privcheck_tcl_bindbackcontinue_exceptionH_rcvdcmd_msgMODE_PRIVATEchanout_butdelete_all_timerssetup_ov_modeTcl_BackgroundErrorsync_whowas_addshitshowuserlistadd_to_logwhois_reggeddelete_windowe_pauseTcl_GetChannelNameinput_clear_lineterm_contadd_userhost_to_userlistdcc_raw_connectH_hookcharset_ibmpcwhowas_userlist_listTcl_ExprDoubledcc_stat_commmy_strnstrtcl_remove_timershowidleTcl_CreateFileHandlerdcc_check_idleTclSeekFileH_nickcx_functionscrollback_backwardsadd_modeTcl_ReadCmdmy_atolH_pubTcl_LreplaceCmdTcl_MainTcl_RegsubCmdclear_setsMDTclDeleteVarsremove_away_logdo_oopswindow_channeltand_zapfbroadadd_wait_promptgot_opssend_count_statTcl_RegExpMatchignore_typemeconnect_to_server_by_refnumset_clonesclear_arraymake_string_vardgets_errnoset_term_eight_bitsavebitchx_variablesput_echonetfingerCRurl_listcheck_mailbless_local_stacktraceservcheck_tcl_ctcphighlight_offtcl_channel_addsearchold_ov_modesave_message_fromdcc_searchlisttgetent_bufsizeMyHostAddrTcl_TellTcl_DeleteKeyedListFieldadd_to_windowdcc_listdestroy_local_stackparse_keyignore_exceptionclear_server_flagswhoadd_process_waitTcl_UpVar2check_protTcl_SetAssocDatafile_writebforward_characterfunny_matchbindcmdvar_settingsstrfilldo_booleanTcl_UnlinkVarMsglist_channelstcl_aliasserver_listtcl_chanstructtbangot_infoalias_special_charH_chatcheck_nicknamebeepcmdunknown_userhostajoin_listput_itserv_rehashTclSockGetPortTcl_LlengthCmdTcl_DeleteCommand2Tcl_AddErrorInfousernametcl_MathInProgresscsayscrollback_forwardswset_variableTcl_SplitCmdchannel_nonopstext_to_processTcl_CdCmdin_ctcpTcl_EventuallyFreemessage_tocheck_tcl_chatnew_windowTcl_VarTraceInfoset_server_awaydo_clonesuser_counte_channeladd_to_channelcmd_chatTcl_ErrnoIdnumber_of_serversn_m_strndupterm_deletecheck_tcl_tandTcl_InterpCmdTcl_InterpDeletedterm_echodo_unscrewexeccmdlast_sent_msg_bodyclear_channel_listclear_tabn_malloc_strcpyrightsredirect_textinteractiveTcl_GlobCmdTclUnsupported0Cmdset_beep_on_msgTclGuessPackageNamesetcmddll_functionsprimary_servermy_send_to_serverwindow_swap4sync_whowas_unshithost_to_ipsave_notifymeta3_charadd_to_a_listTcl_ExitCmdaway_setH_disctcl_versionstrget_server_portserver_list_sizetgotoTcl_FileReadytypesindexset_usernameinput_autoreplyUserListByChannel_TabletclExecutableNameadd_to_tclfunction_itemtoindexTclDater2set_highlight_charforegroundadd_to_historydo_hookTcl_CaseCmdignore_last_nickcreate_server_listtcl_finduserparse_365remove_channellast_servercmd_unbindstrextendadd_to_whois_queuenick_completionreturncmdctcp_versioncheck_whosplitin_bufferadd_bad_nickTcl_SetNotifierDataadd_to_invisible_listdcc_exempt_savetog_fprotmy_encryptset_dcc_bitsTclDatepvflushtcl_descconnect_by_numberNDadd_userattempting_to_connectremove_bansnumcharnewuserscrollback_forwards_linesTcl_Inithash_nicknameTcl_ReleaseCEversionset_socket_optionstand_bootwindow_displaynoneset_server_flagison_returnedconvert_flagsfind_shit_levelawaymsgdcc_activebotresetmatchattrset_blockingTcl_SetChannelBufferSizeclean_whowas_listTclUnsetEnvdo_getoutwindow_swap8window_swap7TclGetOpenModeadd_ison_to_whoisTcl_MakeFileChannelflood_listTcl_CreateChannelfunctionsaddtabkeypanic_dump_call_stacktime_formatadd_to_screencdcc_timer_offerstreqTcl_CreateCloseHandlerH_kickfetch_userhostget_timeTcl_SetKeyedListFieldparse_noticemalloc_str2cpysave_idleusagedcc_statsserv_rejoinshow_server_mapinput_beginning_of_lineforcmdtclXWrongArgscmd_actm_3catget_server_qtailupdate_statsset_level_by_refnuminput_delete_previous_wordfind_commandargs_strwindow_key_killTclParseQuotescheck_tcl_kickfset_variablectcpmax_recursionsdcc_chat_transmitset_msglog_levelw_helptandout_butdcc_checkparse_linefunction_shiftaddidlestripTcl_KeylgetCmdTcl_SetChannelOptionfind_array_itemget_input_prompttcl_channel_modifycursor_in_displayTcl_Preserveis_bound_to_windowcommand_completiontcl_datebackgroundtell_whomTcl_CreateSlaveinput_delete_next_wordend_of_whoisTcl_PkgProvidewho_nickTcl_HistoryCmddelay_notifycheck_auto_replycbootlist_strnicmpchannel_statsinit_keys_1RawHashinput_delete_to_previous_spaceTcl_GetOpenFiletcl_Pending_timersupdate_user_modedelete_arrayserver_is_connectedshow_windowcx_linewhois_ignore_msgsTclWriteFiledcc_dllcommandsset_lastlog_sizecheck_wait_commandremove_all_from_arrayH_rawis_valid_processSFstrmcat_ueinput_unclear_screenserv_unauthget_wset_string_varalias_stringkill_processdo_4opTcl_DbCkreallocmircansiclear_linkchild_reaptopic_lockTclInterpProcfind_moduledcc_ftpcommandTcl_FconfigureCmdTcl_DeleteFileHandlerTcl_UpVarcharset_grafpretend_cmdflush_channel_statsTcl_GetPkgLibraryPathcdcc_minspeedget_dllstring_varconvert_swatchmake_local_stackfind_in_server_listreturn_exceptiondescribeTcl_FileEventCmdreal_dcc_filesendtand_privmsgTclCreatePipelinefile_eofadd_userhost_to_dccextract2Tcl_DbCkallocTcl_ValidateAllMemoryclean_flood_listnew_input_beginning_of_linedcxchild_deadirc_pathterm_cursor_rightfind_name_in_hooklistfunction_setitemC_noticetremove_ignorequery_hostwhois_nicknameTclFreePackageInfotgetflagdcc_ftpopensend_2commreinit_statusnewnicklast_input_screenfind_userlistadd_to_whowas_bufferrealname_cmdtcl_list_timerTcl_DoOneEventdestroy_call_stackcpu_saverWQ_headfunction_decodenew_closefunction_numarraysTclDatepgorstristrforwardnickonscrollback_startjnwadd_to_arrayrecv_nickdelay_kickshow_hashTcl_ExecCmdmy_clearTclDatelvalcheck_tcl_nickstrmccatflush_modelast_msgget_target_cmd_by_refnumTclUpdateReturnInfoTclMatchFilesTcl_SetMaxBlockTimedo_loguserhost_nslbitchx_numverchange_userbits_to_lastlog_levelTcl_GetErrnodisconnectcmdnext_expr_failokTcl_PkgRequireadd_autonick_inputfset_string_varswitchcmdfunction_pushconvert_timesigpipesedunshift_cmdTcl_InputBuffereddo_forwardsendlinecmdpath_searchthing_ansimsgcdcccheck_mail_statusTcl_ReturnCmdtcl_channelclose_all_serverdcc_activerawvirtualscheck_tcl_rawjoin_last_invitetype_textflush_everything_being_heldis_cursor_in_displayTclSockMinimumBuffersmatchmcommandTcl_KeylsetCmdget_status_by_refnumoperget_server_operatorumodesclear_windowlogfiletraverse_all_windowsuserhost_ignoreTcl_DeleteTimerHandlerMODE_LIMITget_signoffreasonfunction_numitemsfree_lastlogwho_hostset_channel_windowinternal_versionTclCleanupProcfunction_cool2find_raw_procTcl_ReapDetachedProcsTclExprFloatErrorTclCreateCommandChannelextractcall_user_functioninput_transpose_charactersunlock_stack_framecharset_lat1ison_notifyinput_end_of_lineTclDatecharIMis_numberhostnameinput_forward_wordpop_cmdterm_putchartcl_randwho_fromdcc_erasenew_openset_wset_string_varremove_bracketscommand_existswap_channels_win_ptrTcl_GetChannelInstanceDatatime_diffH_inputoutput_screenTcl_AsyncReadyTcl_UplevelCmddeopcmd_bindgetchannicktimed_serverfunny_stuffdebughookdelay_opzTclSetEnvC_ctcptand_chanTcl_OpenTcpClientget_line_returndumb_modeTcl_WaitForEventTclDoGlobC_dccospeedTclSpawnPipelinefind_in_list_extlinklookset_notify_levelclear_window_by_refnumset_current_commandTcl_PackageCmdrandomnickallreset_nicknamefile_copycset_variableDLlast_sent_topicdo_tracetparamlock_stack_frameban_is_on_channelTcl_AppendElementn_reallocmy_stricmpscanstrdcc_close_nick_alldll_commandsTclGetEnvcdcc_plistshow_whowas_debug_hashtablepush_cmdcmd_quitfunction_indextoitemTcl_Flushdump_call_stackBLBCget_prompt_by_refnumTclDatepactnew_selecteval_inputlistfrom_serverclusterinput_backspaceTcl_LmatchCmdget_channel_voicein_window_commandget_ignore_typesTclRegCompTcl_AllowExceptionsdo_stack_setget_server_motddcc_getfile_resumeswap_next_windowunstop_all_windowsrepaint_windowxtypecmddo_historyTcl_PwdCmdTclpGetTimeZoneis_on_channelhandle_server_statsremove_from_server_listTclParseNestedCmdtcl_validuserTcl_Reallocfunction_getitemlower_tabmy_signalmax_windremove_from_list_extremove_csets_for_channelstubcmdcheck_mode_lockparse_commandinput_clear_to_boltcl_userhostdcc_bot_transmitset_prompt_by_refnumfind_user_levelfix_status_bufferTcl_Alloctcl_add_timerwholeftwhowas_splitin_listnew_next_argTcl_GetAssocDatakickerdo_notifyfunction_finditemTcl_GetChannelBufferSizeclient_botrecalculate_window_positionsnext_nicklistnext_userhostoper_requestsnotifyfind_userhost_channelcheck_is_ignoredinit_screenTcl_Readjoined_nickget_window_by_namepublic_nickset_socket_readcheck_tcl_topcclose_serverTcl_ConvertElementcurrent_refnumwhois_opercreate_sorted_userlistin_server_pingmy_scrollforwardTcl_LrangeCmdget_server_qheadignore_usernameslast_chat_reqtclActiveFlagCMmove_windowwindow_swap10LocalHostAddrget_linemsg_listcheck_floodingTcl_DStringGetResultadd_var_stub_aliasTclDate_TclDateswho_on_joinTclIdlePendingTcl_CloseCmdtoggle_cloaknwhoisDCunset_window_current_channelTclSetupEnvdo_mynamesTcl_FindExecutableTcl_GetKeyedListFieldset_screens_current_windowkickidleprocess_dcctand_whomTcl_GetFilewaiting_inadd_last_typeTcl_VarTraceInfo2TclChdirget_target_by_refnumhard_uh_notifydokickTcl_QueueEventidle_timemeta5_charC_msgfunction_rmatchitemshow_channel_syncTcl_EvalCmdquote_chargetnextnicklast_notify_nicktracekillremove_from_lastlogH_rejnLocalHostNamelocalreset_line_cntlookup_userlevelcTcl_SetResultH_modesend_umodenumeric_listoper_killsdelete_timertell_whoTcl_VwaitCmdTcl_DeleteModalTimeoutbackward_historyrecalculate_windowsH_linkremove_oldest_whowas_hashlistcheck_tcl_pubmTcl_GetBooleann_freesend_ctcpencrypt_cmdfind_name_in_genericlistcx_fileTcl_DeleteExitHandleruserhostfunny_listMODE_INVITEremove_wsets_for_windowTcl_GetCommandNameTcl_EofCmdTcl_NextHashEntryfunny_modeget_server_lagTcl_SeekCmdTcl_TimeCmdxterm_settitleuser_is_awayMODE_TOPICkickbaninit_inputTcl_AsyncMarkwhokillCLon_offTcl_LindexCmdwaiting_outcmp_infoioTcl_SetCmdtcl_Pending_utimersechocmdwindow_swap3update_inputTcl_EvalFileadd_name_to_msglisthistoryTcl_PrintDoubleencodecompile_time_optionswill_catch_break_exceptionstoggle_stop_screendcc_glistTcl_IncrCmdfindportssave_variablesset_continued_linesarray_popconvert_str_to_flagsterm_cursor_leftdcc_ostatsadd_name_to_floodlistversion1not_warnedchange_server_nicknameadd_ban_wordexpand_twiddlein_chelpTclParseWordsgot_initial_version_28add_to_window_listadd_no_floodH_ctcrbflagH_botTcl_OpenCmdtcl_dccstatshook_functionsuserhost_banTclLoadFilelastlogcheck_splitcurrent_on_hookloading_globalsave_formatsprint_ircop_flagsH_chofparse_numberTclGetFrameH_msgmwritablesinsert_boldTcl_ArrayCmdclient_exitsTcl_CreateInterpget_count_statTcl_CreatePipelineset_non_blockingcheck_tcl_pubTcl_WhileCmdTcl_LinsertCmdnew_keyTcl_AsyncDeleteremove_from_mode_listmove_indexno_flood_listdo_msaycheck_tcl_partmassdeopTcl_UnsetVar2init_dcc_chatpluralset_dllint_varH_partclear_bansdcc_chatbotreal_channelget_from_historydcc_sendfrom_queuetimer_unbanclear_whowasload_levelLEget_server_flagtcl_chanlistTcl_IsSafeparsekeycmdTclCloseFilefunction_ifinditemTcl_SubstCmdgot_userhostfirst_timeTclRegExecTcl_FlushCmddoing_noticeH_chonset_stacke_nickTcl_ContinueCmdunflashclear_sorted_nicklistTcl_BreakCmdget_reasonTcl_LsortCmdcheck_autologptropen_ftpgetredirectTclGetExtensionircop_flags_to_strtcl_putallbotstoggle_insert_modeno_hook_notifyTcl_UntraceVarTclDateactTclTestChannelEventCmdstart_timeTclClosePipeFileuse_inputnslookupfset_arrayirc_exitnumbered_commandsplit_up_lineclient_connectsmode_lockH_aliasadd_delay_notifyterm_beepdcc_no_floodshookTclpGetClicksinterpadd_to_listtcl_commanddeadwhois_namedisplay_server_listTcl_Sleepadd_timeris_cryptedTcl_OpenTcpServerTcl_ErrnoMsgtcl_strftimedead_children_processesset_server_nicknameserver_lastquery_cmddo_ctcpget_int_varwhois_ignore_noticesTclDateexcaTcl_SplitListfile_readprepare_commandTcl_DStringFreewindow_swap9Tcl_DbCkfreechan_structget_chan_from_join_listfigure_out_addresstransfer_bufferTcl_InitMemorycrypt_msgredirect_msgcurrent_filenameTcl_UnsetVarshow_word_kickwindow_key_balanceterm_resizeterm_pauseget_server_versionTcl_GetFileInforegister_dcc_offergrab_http_startWIDTHTcl_ErrorCmdwhilecmdbeep_emchange_window_servercreate_channel_listswitch_channelsstrftime_12hourdcc_bytes_intcl_tellbindsautoreply_arrayTcl_ClockCmdTcl_InitHashTablewild_matchTcl_LemptyCmdrebalance_windowscheck_help_bindtputsterm_insertsplit_CTCPedit_charget_window_by_refnumread_fileclear_fsetdo_notice_ctcpTclDatevTcl_DStringEndSublistinit_builtinspurgeshow_hookprepare_addshitmain_screenhandle_tcl_chanfunction_igetitemcountryTcl_SetCommandInforfgetsTcl_GetHostNamesetenvcmdwindowcmdbircrc_fileunset_current_commandwho_leveldo_offersterm_eight_bitsend_whomcheck_last_typeno_such_nicknamemake_notify_listclear_bindingsTcl_DetachPidswhois_servercheck_hackget_server_nicknameupdate_window_status_allremove_from_listdo_chelpdcc_max_rate_outTcl_GlobalEvalunclear_window_by_refnumcheck_server_redirectTcl_GetChannelOptionstatus_update_flagmeta1_charfunction_addtabkeyTcl_Seekset_scroll_linesopflagsTcl_SetVarTcl_RelativeExprdefbanone_to_anotherdll_loadTclLoadedPackageHandleget_bound_channelTcl_CommandCompletetcl_putscrH_cmdtcl_ctimeadd_whowas_userhost_channelirc_clear_screens_watchabortcmddcc_raw_transmitprepare_adduseraccept_server_nicknamecmd_helpspaceis_usercheck_auto_inviteMBmeta7_charopen_file_for_readread_server_fileSRdestroy_aliasesTcl_DStringAppendElementfunny_namreplyloggerofferlistTcl_DeleteHashTablelowerTclFindElementTclPlatformInitTcl_KeyldelCmdTcl_DeleteAssocDatabackward_characterWQ_tailnext_windowirc_quitlog_deniedprocess_is_runningTcl_FblockedCmdTcl_AppendCmdfree_formatstcl_putlogprotflagsdcc_close_alltcl_utimerSEset_floodget_nicklist_by_windowlame_wait_nickwindow_grow_onewhohas_nickinit_hashdump_load_stackTcl_DStringAppendyellTcl_GetCommandInfosocketsircservers_filenext_exprgot_tcluserhostNLread_away_logICUS___crt_dummy__check_whowas_bufferircpanicalias_awayget_ctcp_valcmd_cmsgget_subarray_elementsoncmddcc_chatctcp_quote_itTcl_CreateEventSourceserv_klinesfget_string_vartcl_unixtimemessage_from_leveldo_unkeypanicnew_new_next_argfunction_delitemnever_connectedstrip_ansi_in_echobantypetmplinktcl_getcommentdecrypt_msgfunction_unshiftTcl_ResetResultcreate_additional_screensync_nicklistnick_collisionsmy_scrollbackmassbancurrent_lineignorestrmcpyrename_nickget_channel_keycurrent_targetmake_statusdcc_rejectTcl_DeleteEventsfunction_popH_pubmstrip_controldgetsUEtcl_timeov_strcpyH_ctcprefresh_inputlinecheck_whowas_nick_buffercdcc_numpacksn_malloc_strcatPCTcl_GetDoubleclonesunloadwhat_channelTcl_CreateMathFuncinput_yank_cut_buffertcl_versionconnect_next_nickstricmp_tableMODE_MODERATEDadd_split_servermeta4_charTcl_RegExpExecTcl_DeleteHashEntrytcl_setcommentpassword_sendlineTclWaitForFilewindow_listextended_handledsend_who_toterm_clear_to_eolshow_wholeft_hashtablefunction_delarrayclose_all_dccget_string_vartcl_initremovewild_from_listinput_add_characterTcl_ForCmdn_m_strcat_uesserv_fakesset_string_varTclDatechkget_refnum_by_windowfile_closeremove_hookcpu_saver_onm_e3catin_add_to_tclswap_last_windowinit_varsstripansicodesremotefunction_cparsefind_locked_stack_frameTcl_WatchFileidlechan_listwindow_queryTcl_UnsetCmdTclDatenerrsnothingin_on_whoban_itset_dllstring_vargettabkeyfunction_getarrayskey_pressedTcl_Writeopen_compressionservercmdcurrent_windowremove_trailing_spacesTcl_DontCallWhenDeletedbreakcmdTcl_GetChannelTypeip_to_hostadd_name_to_hooklistH_filtrsindexifcmdcdccTcl_GetVardcc_filesendcheck_whowas_chan_bufferTcl_Backslashwindow_key_movefunny_print_widelistTclTestChannelCmdnext_arginsert_blinkdoing_privmsgdumpcmdDCC_get_current_transferdouble_quoteswap_previous_windowfind_indexx_debugcharset_sizeTcl_IfCmdTcl_SetStdChannelcheck_tcl_inputfunction_matchitemcmd_tclnotify_markdefault_swatchlast_sent_wallsend_commandmy_decryptTcl_SetErrnosent_nicktclTimerTimeoutfecheck_channel_matchtcl_getchanhostopen_ftpsendrestore_message_fromstat_convert_formatH_dccdll_ctcptand_commandlast_dccSOdoopTcl_WaitPidFixColorAnsiset_server2_8aliasctlin_cparseauto_strmainTcl_GetsH_topcset_lastlog_msg_levelTcl_InputBlockedexpand_aliascut_bufferopen_file_for_writeremove_oldest_whowassafe_new_next_arguserhost_returnedbuilt_in_aliasare_you_oppedtcl_utimersscrollback_backwards_linescheck_valTcl_RenameCmdshow_notify_listlast_invite_channelstackcmdset_input_promptTcl_AppendResultprint_funny_namestcl_pushmodeget_server_awayshift_cmdTclDatedefflush_on_hooksupdate_channel_modealias_illegalslocalcmdmalloc_sprintfwho_realTcl_SourceCmdorg_nickTcl_DStringSetLengthTcl_DeleteChannelHandlermeta2_charwhois_helpfulclear_all_windowsmatherrirc_portadd_serverawayTclWordEndtgetentmknunumber_of_windows_on_screenconnected_to_serverBScolor_strevalserverTclCreatePipem_s3catlookup_functiongethashtabledcc_timedo_igget_cset_int_varlast_noticeawaylogTcl_SignalMsgsent_bodydo_invitesave_banwordsTcl_PutEnvtcl_onchanis_channelTcl_DeleteCommandadd_tcl_aliassetup_additional_screendcc_message_transmithandle_dcc_botH_noticeoh_my_waitTcl_PidCmdtcl_channelsignored_nickssend_channel_comfind_itempingcmdsave_bindingsTclGetLoadedPackageslookup_channelTcl_StaticPackagemake_fstring_varreset_clockshit_countreadablesfunction_getrmatchesTcl_ExprCmde_callhelpadd_module_procbuild_server_listlast_servermsgset_var_valuecheck_timersis_chanopTcl_MakeSaferelay_helpget_channel_moderepeatcmdlkwTcl_ExprBooleanremove_packagesplitwTclGetAndDetachPidsadd_userliststatus_updateparse_serverdcc_chat_transmit_quietLISGsorted_nicklistglob_cmd_aliase_privmsgdcc_resendmake_new_AliasH_msgchannel_server_deletecaps_fucknutbsd_globfreeis_bound_anywherecontinuecmdshowshitlistC_tandwait_nickwindow_check_serversdisplay_keyusersTcl_GetIntTclCopyAndCollapsewhois_lastcomTcl_AsyncCreatewhoistclTypeTabledcc_commandsTclDate_TclDatevchan_is_connectedsend_modetimercmdquerycmpinfodoneget_server_itsnametcl_serversfudge_nicknamewhois_adminremove_fileset_int_varuse_flow_controlTcl_GetPathTypebsd_globclean_whowas_chan_listm_s3cat_stcl_chflagtcl_msgTcl_PutsCmdsleepcmdm_sprintffile_readbirc_libtand_joinlog_togglescroll_windowmsg_fpdcc_printfLameKickdo_uptimefreadlnMODE_ANONclean_up_processesinit_ftpTcl_Eofget_arrayuserhost_cmd_returnedlame_listcmd_bootwho_nameTcl_FirstHashEntrycheck_tcl_joinwhois_ignore_invitesexec_server_deleteadd_name_to_genericlistkey_namesshow_versionTclDatevalreally_savein_join_listinput_move_cursorzeroircrc_fileadd_to_userhost_queueTcl_RegExpRangeis_other_flooduser_listflags_neededMETclGetDateltoaTcl_UpdateLinkedVarserv_splitstart_fingerrandom_stradd_to_whowas_chan_bufferdcc_close_type_allcheck_versionTcl_ForeachCmdTcl_DeleteTracelast_function_call_levelwhois_channelsparse_server_infonew_display_lineshow_wholeftinput_clear_to_eolinstall_packcheck_utimersno_forkim_on_channeltclPlatformwho_filesave_settingsnext_namelistis_channel_modecntl_cerrorremove_logtcl_isopsig_refresh_screenMODE_KEYset_user_infoTcl_SwitchCmdfind_name_in_floodlistdebugmsgupdate_all_windowsuser_changing_nicknameTcl_CreateCommandcdTcl_ProcCmdadd_tcl_varscursor_to_inputTcl_ListCmdwindow_shrink_onemultkickhighlight_charset_autoreplydo_mapirc_versionmeta6_charTcl_LappendCmdqueuecmdtand_whoonenext_in_comma_listdcc_close_client_numfind_fixed_array_itemtcl_killtimerTclFindProchandle_tracekilllist_lookup_extdo_umodewill_catch_return_exceptionsTcl_SetPanicProctrigger_bindadd_to_server_listlookup_ipuzfopenTcl_UntraceVar2get_window_by_descset_server_bitsreload_savelogical_to_indexserver_redirectreconnect_all_channelsprevious_windowov_windowclear_variablesadd_channelremove_oldest_chan_whowasis_rootreal_check_autoTclInterpInitreinstate_user_modeshookcmdparse_lastlog_levelcheck_shitserv_actionwho_maskunload_dllupperdcc_chat_crash_transmitTclParseBracesaboutH_signTcl_RegexpCmdadd_cmd_stub_aliasrandreasondo_processesauto_joinadd_to_irc_mapquotecmdTclIsProccreate_new_screendo_stack_aliasset_operview_flagsfind_servermy_next_exprcommentTcl_GlobalCmdkill_screenchange_server_channelscheck_tcl_signTcl_CreateAliasm_openduptcl_putservmake_window_currentfunction_getmatchesTcl_LvarpopCmdset_server_operatorTcl_GetAliasmove_window_channelstand_zapfcall_functionterm_scrolluseragemy_whoisTcl_GetVar2Tcl_InfoCmdremove_from_channeltignoreTcl_DumpActiveMemoryTclReadFileparse_server_indexwindow_swap2get_channel_operset_notify_handlerscan_socketsTcl_TclCmdritefunction_gettabkeycursor_not_in_displayset_lastlog_levelflood_prottcl_botslog_successmy_scrollendin_completionlast_sent_ctcpTcl_FindPackageHandleTcl_TellCmdwaitcmdfind_name_in_msglistscrollback_endTcl_SignalIdannoy_kicksget_inputTclOpenFiletyped_add_to_whois_queueget_historyTcl_GetMasterH_spltdocmdTcl_UpdateCmdfind_hookfind_dll_commandlog_put_ittime_strget_pending_nicknamestrformatchatismerealnameTcl_DoWhenIdleinput_delete_characterlookup_fileTcl_CallWhenDeletedinsert_underlinel_plistset_window_serverorig_nickrename_filetcl_loadlast_ctcpset_inputinit_msgTclDateparseTclDateerrflagEIALtime_to_next_minutecmsgmy_ctimeAdd_Remove_Checkshove_to_historyfunction_sendcdcccheck_syncTcl_CreateTimerHandlermultigetTclNeedSpacewhowas_nameset_server_versionfind_func_aliaschar_fucknutoffmatchclient_invalidfunction_getkeywindow_swap6MODE_MSGSget_dllint_varTcl_AsyncInvokeadd_nicklist_to_channellistremove_allremove_module_procnot_on_a_channelTclGetRegErrorH_functionsTcl_Closequery_nickwindow_swap1ClientListTcl_KeylkeysCmdTcl_Evalnew_fileget_builtinsauto_awayfingerTcl_CreateExitHandlerH_joinget_pending_bytesrecreate_modeadd_local_aliasTcl_ParseVarcheck_tcl_splitcmd_saytcl_putbotterm_putsTclDatedebugputlogTclCleanupChildrentcl_timersTcl_CreateTracewindow_swap5set_server_qheade_walldelay_check_autoshow_bindinge_quitsave_aliasesTcl_SplitPathconvert_output_formatget_flood_countcreate_csets_for_channelclient_bot_alarmlast_topicTcl_RegExpCompileBreakArgscmd_invitemassopfind_bestmatchstats_reqbitchsayTcl_OpenCommandChanneln_mallocwhois_nicktoggle_xlinkTcl_JoinCmddcc_raw_listenTcl_CreateModalTimeoutbanstatnickinshitdcc_close_filenameTcl_AfterCmdsync_whowas_adduserdo_statsopen_file_for_bwritechannel_chopsinsert_reverseget_umodecmd_echohide_windowcreate_fsetstcl_getchanmodetimer_idlekickTcl_MakeTcpClientChannelquick_startupdoing_whodcc_max_rate_inwindow_key_hideMODE_SECRETn_m_strdupTcl_DeleteEventSourcem_3dupsync_shitlistreconnect_cmdwhois_servicessend_lineword_countTcl_DStringResulttcl_findshitstrmcatshow_alias_cachesfunction_ifindfirstwhowas_reg_listthree_starsset_server_motdinput_msgreplybackTcl_SetVar2send_commTclPrecTraceProcstristrinhibit_loggingadd_to_lastlogget_process_indexsplit_linkm_2dupTcl_GetSlavestripansisig_user1check_serverlagadd_var_aliasTcl_JoinPathTcl_PosixErrorspingkeysshitlist_listrbindcmdaliascmdfunction_cdccdcc_plistchange_input_promptmy_pathlogmsgregister_serverremove_userhost_from_userlisttcl_putdccPasteArgscheck_tcl_modeinit_window_varsTcl_CancelIdleCallcheck_tcl_dcccheck_tcl_msgmTcl_LoadCmdget_notify_nickstrace_handlekilldebug_userset_server_qtailCOdisplay_bitchxwalk_channelsTcl_LinkVarbanunbanrefresh_screenfunction_eleetstrflagssplit_watchUPread_netfingeradd_to_list_extadd_cmd_aliasneed_redrawclean_whois_queueTcl_LsearchCmdTcl_GetChannelFileTclDatepsTcl_UnregisterChannelwindow_key_listdccget_server_whois_stuffforeachshow_whowas_hashtablenicknamedo_serverxdebugcmdTcl_DeleteCloseHandlerTcl_DStringStartSublisttcl_bindparse_inlineget_server2_8is_server_connecteddcc_activepanicProcloadchopTclGetCwdadd_to_join_listinit_variablestand_partTcl_TraceCmdcreate_wsets_for_windowdebugfuncinsert_indexis_current_channelmove_word_relget_win_from_join_listcheck_tcl_ctcrserv_squitsis_server_opensend_whoTclpGetSecondsTcl_DStringInitTclDatestclMemDumpFileNameset_waiting_channeldo_send_textremove_from_arrayconvert_flags_to_strisonlast_wallH_fildo_togglefakewho_serverTcl_StringMatchcurrent_numericdo_scanlast_split_serverChanWallOptclInInterpreterDeletionwind_indexTclSetInitScriptset_history_sizeremove_window_from_screeninput_backward_wordget_bind_typecheck_tcl_aliasTcl_SetErrorCoderesize_windowsend_numpackscheck_server_connectscreen_listresolvset_server_passwordget_window_serverset_log_filedisplay_msgadd_shitTcl_GetCommandPathget_help_topicison_nowredraw_all_windowsmeta9_charstrmopencatinvite_channelCSTclRegErrore_hostnamemake_channeldcc_crashUserListByHost_Tablemasskickbanclient_floodsparsing_server_indexTcl_ConcatCmdsend_killTcl_GetKeyedListKeysin_timed_serverset_screensprint_ctcpmy_strnicmpchelpTclFindFileChannelTcl_GetsCmdclear_screenTclDatestateignore_nicknameget_child_exitinputcmdlookup_hostchange_to_splituserhost_clinkget_cmd_aliasdelete_display_lineban_wordse_debugshow_nicklist_hashtableTcl_HashStatsextern_writeforward_historydcc_opensend_kickTcl_ExprStringTcl_RegisterChanneltcl_maskhostTcl_FileCmdtclFirstEventSourcePtrfind_nicklist_in_channellistTcl_TraceVar2last_arginvisible_listterm_resetTimerTimeoutTclDatetmpclinkevalcmdwhowas_chan_listTclpGetTimeFromUserHostdo_newuserlist_lookuptcl_onchansplitcheck_tcl_rejointgetstrTcl_OpenFileChannelurl_grabberreinit_autoresponseTcl_CatchCmdhold_modeTclExpandParseValueH_helptcl_killutimerremove_from_join_listend_strcmpstrftime_24hourset_current_channel_by_refnumoutput_lineget_flood_rateset_server_itsnameset_cset_int_varTcl_VarEvalnext_userlistwhowassend_textdestroy_sorted_userlistTclGetListIndexlast_split_fromtabkey_arrayget_connectedcheck_split_serverTclServiceIdlein_helpget_a_charupdate_all_statusTclDater1oper_commandnumeric_bannercheck_ignoretcl_putcmdlognickname_sendlinedo_check_timersto_windowtcl_irciiwho_handlekillinput_autoreplybackdodeopadd_userhost_to_channelTcl_SetRecursionLimitov_serverTcl_Exitin_ctcp_flagirc_exit_oldTcl_GetNotifierDatafind_server_refnumdcc_bytes_outTcl_UpvarCmdadd_mode_bufferTclPreventAliasLoopTcl_GetInterpPathupdate_clockflush_mode_allis_boundis_ignoredserv_connectsmove_array_itemsassigncmdm_dupchardcc_regetfilemessage_fromTcl_Freetcl_clientsemptydcc_active_countsync_whowas_unuserget_server_nametputs_baud_rateparse_364TclCreateTempFileTcl_ExprLongTcl_CreateChannelHandler()p(x((}))*@*t( *l%Hp%t%(x%|%"%%%Z%%p%k%X%G%!%K%%E%%[%#%\%%A%N%/%%%'%R%%%g%%Q%%%0&s&=&w &^&&&&* &W$&`(&,&q0&{4&8&8<&-@&9D&5H&jL&P&:T&JX&L\&7`&~d&)h&l&xp&Dt&x&|&r&&4&z&]&1&&.&P&&M&6&%&B&_&e&c&o&|&&&&a&>&&&&&&&&&V&'Y'' '$'h'';'u '$'C('v,'0'F4'8'<'@'D'fH'L' P'yT'lX' \'`'nd'h'l'p't'x'|'T'''?'S''d','I'O'2't'''<'3'U'+''b''m[[ 5d%%h%%l%h%p%h%t%h%x%h%|%h %%h(%%h0%%h8p%%h@`%%hHP%%hP@%%hX0%%h` %%hh%%hp%%hx%%h%%h%%h%%h%%h%%h%%h%%hp%%h`%%hP%%h@%%h0%%h %%h%%h%%h%%h%%h%%h%%h%%h %&h(%&h0%&h8p% &h@`%&hHP%&hP@%&hX0%&h` % &hh%$&hp%(&hx%,&h%0&h%4&h%8&h%<&h%@&h%D&h%H&hp%L&h`%P&hP%T&h@%X&h0%\&h %`&h%d&h%h&h%l&h%p&h%t&h%x&h%|&h %&h(%&h0%&h8p%&h@`%&hHP%&hP@%&hX0%&h` %&hh%&hp%&hx%&h%&h%&h%&h%&h%&h%&h%&hp%&h`%&hP%&h@%&h0%&h %&h%&h%&h%&h%&h%&h%&h%&h %'h(%'h0%'h8p% 'h@`%'hHP%'hP@%'hX0%'h` % 'hh%$'hp%('hx%,'h%0'h%4'h%8'h%<'h%@'h%D'h%H'hp%L'h`%P'hP%T'h@%X'h0%\'h %`'h%d'h%h'h%l'h%p'h%t'h%x'h%|'h %'h(%'h0%'h8p%'h@`%'hHP%'hP@%'hX0%'h` %'hh%'hp%'hx%'h%'h%'h%'h%'h%'h%'h%'hp%'h`%'hPYЃ1UUUPSQ̀D$h*Php,PD[t&'̀&US\%=\%tЃ;u]]É'U]ÐUWVSuE PE PÃujGjhx,S ulPh{,+Ph,+PPPh,+ PPPh,a+&jjS薹E E 'E x} P<v<v t߀ tڋE tuME8-u5xt@PXh-*&'P*{j}j{x} @Pf uVh?-*v'A9t9v<v<v t uA9uހ9tVQhU-1* U :t0<v<v t uE x} PxuҋE PEP) hhy-EP賓e[^_]É'U名E PE PϜtjjPP׍v]ÍUE PE P荜uj]Ít&'jjP薷E E 'E HM P<v<v t߀ tڋE t8u>E8-u&xt@P1t&h-(Pt&PEPFhhy-EP耒]ÍUWVSE PE P蚛Rà uh- 0щHPh-Sƒ u 1K0щHPh-S[ƒ tSh-_,v'E PE Pǃuh-Y&'E 'E E@E EP<v<v tۀ t֋U t:uh-+h-EP i?tdj,WÃtCjjW|‰U uE PRv t&E PR&hchy-EPА߃ ue[^_]Í'UVSE PE PۙƃujE t=8t2<v<v t uU JM Bt zu΃} uWE {Nv>tJj,VÃtCjjV|‰UE PRMhhy-EPރ ue[^]Ð&UVSUEEE t8uK}tRh.* Et&jijbj[=uE PE P菘Ãjh .S蕝 hT|h.VZEPqEhhy-Vh.EPÃ$t,jSojSWjSߗjS ShT|h.%hhy-EP虎5jh..S u 臺jh0.SÜ u j~&jh2.S補 u j^&jh6.S胜 u 'jh8.Sc u jh;.SC ujq'jh>.S u <FjhA.S ,蓹j\jUjNy; e[^]Í&US1ۉtBPPShE.$Sh_.$C~1ۉTtBPPShu.$Sh.$C~ċ]]Ðt&UWS}h"hy-j7h#hy-W襐CC0򮡘)ȃ؍e[_]ÐU WVSEPjEP訰EhtP:t#Ph.&9'Uп.uu VRjRt!u VEP} u >EPEPEPhVÃt}|EPShS hkhy-u VCPhlhy-CP2C 0;ҋ{ЍDVEPh. !(&EP hzhy-uVe[^_]Í&UWVS] EEPjEPEhtP萞ƒtEPPh.$EPEPsǃuEPWEPR hhy-SGP0HItSEPh"/!&'SEPh"/ hhy-uV諉e[^_]ÐU WVS] EPjEP‰UEPEPRhDTǃt}|EPWhDQ hhy-SGPhhy-GPG 0HSEPh?/(hhy-uVΈe[^_]Ít&U WVSEPjEPEhtP誜ƒt!EPPhS/# &Uֿ.uh/"&EPEPRhSǃt}|EPeWhP hhy-] SGP辈hhy-GPۇG 0HSEPh/(hhy-]S苇e[^_]ÐUWVS] EPjEPի‰UEPRǃt}|EPWhDO hhy-SGPhhy-GPG 0HSEPh/(hhy-uV跆e[^_]Í'UWVSUEEֿ/u1ۉttPRUUt7C~Ճ}uQEPEPRhQEt)' ME붍&}}Dڅ~JM ytQTE 1e[^_]Ít&UWVS11Tt<t0PMQu%3M G~u3EPM QMQhDrPƃt M |u|~PTJ5T~tEV_~u<PnM '~t 1e[^_]Ít&UWS]S0Ѓ$)ĉRWhhy-S"=u&jh{Wh/ze[_]Í&U$WVSEEE}htEP躗ƒh.uV菑ƒuEEv}ttUItuVEPh/ u֋Ep|4Eu9t UUEP4u܋L1ME0KuVRƒ9uSE܋5Du|.uuuP }0щN9u+]Nt&EPuܡt0E0VBE EЋu4FE9D }u;}|/uVREPEu4FTUR_J }t&ItxE@PuVEPh/t] u4Ep4>u u#It%EPuVh0(U}t/} tEu4FTUE E(} t5VTu 1e[^_]Ít&US]S蠆ShaJE@9u9~hhy-EP蔀hhy-EP~hhy-EPh$hhy-EPR nv']]É'US]SShIE t{@9u9~h+hy-EPh,hy-EPh-hy-EP$h.hy-EPShF0ShX0]]Í&'US]S ShDUHE t{T9u9~hChy-EPhDhy-EPhEhy-EP~$hFhy-EP~Shk0Sh|0]]Í&'UWVSEEEh0}t!MQ60}HE5}F|A19| 5E}t(MQMQFDPu j.MDMPLƒt{MD)Ã}t9]uSMQP MDPSSh07MDE]Ot&'MDBtPPh0 BPPh0 GF9| F”e[^_]É'UWVSEE1h0}t!MQK0}HE19=}t#MQMQP j.MPƒt[)Åt9]uSVPt tiPSSh00]@BtPPh0BPPh0O G9=e[^_]Ðt&UWVSEE1h0m}t!MQ0}HE19=H}t#MQMQDPn j.DMPLƒt[D)Åt9]uSVP$ tiDPSSh0ND0]@DBtPPh0BPPh0 G9=He[^_]Ðt&UUEEPjR]UWVSEE1PU RURMEjPuEP"t X_0}uUPÃu7URÃu%URÃuURÃhhy-EP?y thhy-SH}؍e[^_]Ít&UVSUE uPRkÃt"th hy-PVyC1e[^]Ðt&UWVSu E0}HEhhy-jEPxE19=HMQDPMQ uuj.DMPu[h%hy-DP-|E B 9u)Zh*hy-PEPx| G9=H[>uh2hy-EPwEe[^_]Ív'UWVSEEEE}uED0}HEu hMhy-jEP[wE1ۃ&'u0H9ERuVBǃ9}u<.h0DPƒ}t&DPuVuPU UthhYhy-DPuPu U UA9Eu'Mh_hy-uPEPKvCu9^u tEhhhy-EPuEe[^_]UWVS1ۋ=UjEPURƃ }}xURsh{h.= jjU RVjf   h.ËUuhhy-h{,yÉ؍e[^_]Í&'UWVSu} 19~Nx tt1xth0V=BPPh0V C919H~NDx tt1xth0VDBPPh0VC9He[^_]Ív'UWVSE1uD3v'u t&uPt19^~l1hhy-Pshhy-Pshhy-Ps$hhy-Pps C9^vDKyhhy-VAsFFe[^_]É'UWVS}9Uuhhy-PRhr 9}[ɍAD DDDDDŽA  9|u5s5t' P<DŽ%v P{ PDŽѐe[^_]Ð&US19}!1҉u˜@9|]]ÍvUS ҍB{Ë ҍB]]ÍU P|tj ҍB|tD ҍB<t ]Í&'US] ҍB\]]ÍU PD]U PDŽѐ]Í'Uh|ɍADŽ]Í&UVS|Oh1Kt2ۍC4D0PSh1 hKuh1e[^]É'UVSh,1Kt2ۍC4D0PSh81W hKuhB1>e[^]Í'UhVhy-hn]Ít&'UWVSu0ЃtAXjPHbt!<30u vK<30t<3.uKDvj.Vte[^_]Ðt&UVSu~t"^vPhU1tCF;ue[^]Ðt&UhWVSEEEEEEEрv<v t t܋E8uhm!v'0ҋ}҉UET9v'J<v<v t t} uE {}u-:)u(M9(u AME'u> EEMM}tEЃ]$P'!$$$$ $ $$$$$$$$$$$$$PP $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!&E9t&}u9uu%j)j(FP(ǃ Fj)j(Sƃ tFEPM QSEP‰U!>!hzhe1VMQDljEPM QEP‰U h|he1MQjEEK!t&' Mj}j{^SZǃ u0҉U|}t"'jh{h.XẸ jjM QVjZ   h.‰U}v hhe1h{mEZ v'}t:j]j[FPmǃ ,0҉Ut9t&Fj]j[S0ƃ tF;$ESEjj PRǃUtV:uQ}߉}WhE PWWM Q5‰U E U:-uhzubhWM Q‰UE Xj$Su1j\Su"hhe1SrlE "v'jMQE PS ‰UM9 }0щJ}tӉ]Tt0)р)̉eeEPMQhh0EPZMQEPMh he1MQg$t;>t6VEP$MQEPM QEP'‰Uv'EPEushhe1h{MQgVtR>tMh+he1VEPshMQEPM QEP‰U h-he1MQfEE E8nh:he1h{MQfgQV8}t F\&9uuE~ E}FjEPM QW"‰URkEP‰Uuhehe1h{MQfEP~Ã>+uCKESGRMQkẸ }uKhuhe1MQehvhe1EPehwhe1t&9uL=.}.]jMQE PMQ(É]0҉UT9v: u J9UrE EE@EMQ<v<v tۀ t֋EP‰Ut!:tR6E&'Ehhe1MQvdEPMQE PV4‰URà hhe1MQAd '}]FjEPM QEP‰UjMQE PV‰U MQvEȋEPjhhe1MQchhe1EPc }-u M)ى]hhe1S Pgà ~=uO}uIEU:tSR'hl1M̉ h 9uEE~=?}EjMQE PMQÉ]0҉UT9v: u J9UrE EE@EMQ<v<v tۀ t֋EP=‰Ut!:tjjRj ]v'EEhhe1MQbEPMQE PV‰UjjR hhe1MQ}a v'}EFjMQE PMQj‰UjEPM QVU‰UE jjP ]MjjQ hhe1EP}Dahhe1MQ1am}*uMlfD@uh1O}/u }At&E}E Em$[m}U Um]mؙ}R$]uuh1AgS~=uF}u@EU:tSRt&hl1M̉ h V#u }~~}F=jEPM QEPÉ]0҉UT9vv: u J9UrEvEE@EMQ<v<v tۀ t֋EPm‰Ut!:thhe1Rc E t&Ehhe1MQF_EPMQE PV‰Uhhe1R?c‰U(hhe1MQ_hhe1EPMQm`hhe1EP^](~=uC}u= MU:t SRVhl1VẸhhe1EPx^E3~=@}6jMQE PMQ3É]0҉UT9v: u J9UrEt&'EE@EMQ<v<v tۀ t֋EP‰Ut!:thhe1Ra E t&Ehhe1MQ]EPMQE PVD‰Uhhe1Ra‰U؃(hhe1MQD]hhe1EPMQ^hhe1EP]]܃(~=uC}u= MU:t SRhl1Ẹhhe1EP\EsF8}jMQE PMQR‰URWƒt.jEPM QV.‰UR3Ã1h he1EP+\h he1MQ\h ~&'~=}jEPM QEPÉ]0҉UT9v: u J9UrEt&'EE@EMQ<v<v tۀ t֋EP=‰Ut!:tRրE&'Ehhe1MQ[EPMQE PV‰UR艀à hhe1MQZ!]hhe1EPKzR^Ã~=uJ}uD MU:tSR=&hl16Ẹh V8/ =& } 'F8}jMQE PMQ‰UR|ƒu.jEPM QV‰UR|Ãh8he1EPYh9he1MQYh:he1{yo'~=}jEPM QEP3É]0҉UT9v: u J9UrEt&'EE@EMQ<v<v tۀ t֋EP‰Ut!:tRF~E&'Eh@he1MQXEPMQE PVD‰UR}à h@he1MQQX ]hBhe1EPwRP\Ã~=uJ}uD MU:tSR&hl1ẸhC{V8 = } 'F8}jMQE PMQB‰URGzEjEPM QV$‰UR)zÃ(h_he1EP1Wh`he1MQWhbhe1{9]t{R[ v'~=}jEPM QEP É]0҉UT9v: u J9UrEt&'EE@EMQ<v<v tۀ t֋EP-‰Ut!:tR{E&'Ehihe1MQVEPMQE PV‰URy{à hihe1MQU1]hkhe1EP;uRYÃ~=uJ}uD MU:tSR-&hl1&Ẹhlhe1EPHU V8=} '}FjMQE PMQ‰Uj:j?VuǃGEPwtjEPM QV jEPM QWp‰UG:hv'~~}jMQE PMQ#‰UjEPM QV‰U EPR>ƒt#hhe1h{MQ!&'hhe1h{EPThhe1MQS 'V=.~}FEPTYjMQE PMQq ‰UjEPM QV<‰U]0҉UT$9v: u J9UrEEEE@EMQ<v<v tۀ t֋ MEPXU:tEPRu h1vM̉ hhe1EPI &~=`}VjMQE PMQ3‰UjEPM QV‰U REP<`ƒu#hhe1h{MQ!&'hhe1h{EPRh t&'^8}]jEPM QEP}‰UjMQE PVh‰U MQwEȋEP wÃ}>uEȉ&Eȉhhe1MQDQhhe1EP1Qhhe1v}UԀ=uFv1FMQEPM QEP‰UMQEPM QV‰UuЃ < v-t+uF< wvu< v-t+u_F< wVEjjP衰 ]EjjP莰 EfE@tcEfEu"EEPEP#^Eȃ}t+}؀}}t+MAQEPM QEP&'M< v-t+u)MIЀ whhe1EP&M#t@uUE 'EE8t4PN‰Uu=hhe1h{nP 'hhe1M QMP‰U }}#uEPTEȃt&}@u0}HEhhe1EPKhhe1MQ jEPM QEPg‰UjMQE PVR‰U hhe1RMQLhhe1E t&FjMQE PMQ ‰UjEPM QV‰U EPpEȋMQphhe1EPJhhe1MQJ hhe1#]v'FEPMQE PMQw‰UEPMQE PV`‰U MQpEȋEPphJhe1MQ^JhJhe1EPKJ hKhe1 ]FjMQE PMQ‰UjEPM QV‰U EPoEȋMQwohshe1EPIhshe1MQI hthe13]ȉ]S&iRMZ&FjEPM QEPI‰UjMQE PV4‰U hhe1MQIIEt&Ee[^_]ÍvUMU EjPRQ]ÍU$WVSEEEE}t Muhhe1h{Lv<@u}tEMfMfM0}Ѓ $)ĉeMQRU)U܃}t M3MM}t E<;<$t2<( t&<\<{t&'}t M9@G?hhe1MQRMQX?^u(]GEh"he1SEPIG?^t݋MQEPM QWMQƒ}th'he1EPURG U܉t&}+EMDM'Mh;he1MQRMQWM}}(u)P]SrVUgǃ U܅u4Sh1Uf0ЋU܍< t&'GM MhKhe1RMQGM  EGth\he1MQREPWjC9tEPMQh1Ee[^_]Ít&U,WVSEEE M[uo@E j]P;Ɖut7^ӡp(DPu]EE P#kEEE E j]h1E U BUE(t`."! t&#@*L&{7Ej)j(ReE uj)EPBE t E E jMQMQEPEMQMQMQP]S$EPMQMQEPMQhhe1S^D hhe1EPHDMv'j!R蠬E tE h{EP:‰UEPMQMQRMQChhe1EPCWt&'j}j{RdE uj{h1`t&'E MQMQEPI‰U EPMQMQRMQhhe1EP?Cv'j"R蠫E tE h03jEP8EPMQMQPMQB hhe1hBREPMQMQMQMQME @t&EEhtE @PVÃtC<(u7j)j(CPJc u M&X M EE xu!hhe1MQ.FE MQMQMQ@PEP}#u hhe1EPmJ$&hhe10}HPaPEE EPMQMQEPMQhhe1EPbA hhe1EPLAM{}vUp(DPu}-t }~M}~uE j&}-u*E E PbuC{ &} WaËE 8-u@E Wau ؃}uh0he1h{D PSMQE EPMQMQEPMQh5he1EP"@E i{_'E1E 8$uXHM@ht@PSÃE EСp(DPu}_uf<[u$j]j[CP`E tIXx[t><(u8Cj)j(SW`E u 1'E]} Mt(MQMQEPE PE"t&'MQMQE PE Ut*EPMQMQRMQ;h}he1EP>tM؈ t&'1e[^_]Ít&UWVSU Mu]]t!}؃$)ĉEPQRWH^t,t(0ЍE$)TVRUƒ }thhe1R]S?e[^_] Uhhe1>Ph>] UWVSEPathn|'UREPHSa thnIv'jh1SK u Jt&jh1SK u 1-&jh;.SK t hvEP2at hxUREPGS a thxv'jh1SK u 1M&jh1SJ u *t&jh1SJ t h1EP`t hUREP#GS[` thv'r&SAuEPS u S% EPS&thhy-@u{PlvhUS:AuEPS踰0uEPS EPS薱hhy-jZP'EEEh1SHu{S@uEPS Et&h2F19]~:1EPh{EP>hhy-EP~:C9]hhy-EP_: Eu3h&'hD2hhy-h{B>e[^_]Ð&UWVSE}u- ->u!tuWhT22&}u!M QÃt1M Qf#t&EPM QÃt M Qhhy-j8EXhhy-M Qd=UBt B vB E 1ۋ E@PM QFuE@ &E@ C M Q>E@t}u PhD vPhhhy-EPl8h hy-EPY8t&]C EOWM Qhg2Pt&'u{Wh20tqvCuCPh2?v'PtRCPh0'@PCPh0 [ u h2e[^_]ÐUWVS]} E1S{t9EPEPPS}}U4KjCPEPSUЉ9uU1'ًURE ËUPURM Mt~륐렍Us|.E Ƌ}ǐURPUR輖 u U+} NyF{9}~2E Nj]ÉURPUR脖 uU] G9}ۋ] 0U<H9EuU}tU2E؍e[^_]ÐUWVS}O1|W)E EPMQu)&'} { &s9}Ѝe[^_]Ít&'UWVSu} ]t+hh2PV31$ hh2j01ۋ9~DI9e[^_]ÍvUWVSuM ]9~K9t=F<9})VDA9|t&'VDI9F19^~7vPEP=~SKPh{EP0C9^̋Euhh2h{]0e[^]Ít&UWVS1EUREPQ5tGPDƃt8EE8t)19^~"EPP9~]C9^hh2UR0KP/e[^_]Í'UVSEUREP4tUPƃtFE8t>19^~7vEPP~SJPh{EP/C9^̋Euhh2h{/e[^]Ít&US1ۍUREP4tPtXhh2S6JP.]]ÍUVS1MQEP3tE  ht/hXh2D@PhS("'hZh2j ' @SVGPh2S?0HPS:t&j~h23}t3PhHjh2U Rh3 hh2Vhhh2h3h U9PPGPh3Sw0HPSrhh2h(hh2hjjh [^_]Ð&UWVSjjPƃ tu0t(h&PjCPjh$3VuٳaPh&3W艂hPjWjh$3V(Àz~V[^_]É'UWVS1E=22f2fD|E t$8tPܺtE PE P#ÃjShvƃ E /3t8tRh03EP jV_ÃtO1ҋC t P|{u%{utujEPCPjjVSV`_ÃuVhh2EPh=3=e[^_]Ít&UVSu22f2fD|EtPhh2EPhh2EPtEhh2EP\]$ue[^]ÍvUMȅt9t3*t)!t" .t@t?xt xt@uljȉ]Ðt&U WVSuE] ]22f2fD|*0C߈щH wJ$XYXXY Y@Y&V蚷PShv3CVh3&j.V{Ph3h*@{VZREPh3h*WVShv3]S EPPh*whh2Sv'VSEPh3h*~*e[^_]ÍU WVS]EE M22f2fD|t9t3} s3 tM QP%} jMQM Q}J t6PBPBPh3EPM Qh3蟭*v'MQM Qh3~ '}  (t&CP‹CPRPh3EPjjhƃ u%h8h2EP"'0t]{ uOEPCPuCPEP}t'h\ PjCPjh$3V(C EuV#}uMQM Qh3x hJh2EPrM e[^_] UWVSEEEEE22f2fD|_]SEP-ESEP EPh&4"؋EPh+4"%E}t-u4E th4Pu DžDžjWUÃCPCPh3Rvu!u{urv'{tbPMPCPe tFRVt2RjCPj4t4PWSWQTÃDW~uGPVEu4Ph4[^_]Í'U WVS]1h%122f2fD|tGƅE PE P{Ãu1ۅtS6u1jShà tkuE PE P4ƃt?v>t7RjVj4t4PS2E PE Pƃ uS&[^_]Í'U WVS]122f2fD|.1hƅt)h5Sth 5SuE PE P$ÃtSu1jSPà t\uE PE Pƃt<>t7RjVj4t4PSE PE Pƃ uS[^_]É'UWVShDžDž22f2fD|a}thc1E PE Pà utS蹫u1jSP_ǃ JuE PE Pƃu4>-u4t&E th4P>DžjWiPÃCPCPh3RrPlIPCPtaRVntMt {u{t{u2RjCPj4t4PWSWOÃVWuGPVEu(5Ph4X[^_]Ít&'U(WVS]EEEDž22f2fD|1E PE PǃutW賩u1jWEP\ u7E PE Pƃu!SEu/5Pރ'E t.jh4Pm uDžE PE PNU t:u Džj&GPw}PGPh85EPu%tjP^PGPGP~ EPV uVGPtahh2jËGPh2CPlhh2ujGP蝣PCP(SEPsUhh2EP WR Mǃ}61DžBPK5t?5PhS5r] CPCPBPht5Ran0Ѝthh2RR$~,Ph2M1hh2RgtPh2^Mhh2PEPv'BPVh5[[^_]Í&'UWVS1ۡE22f2fD|U tHtB<#t,<&t(jh5Rij tu 4uE PE P ÃjSEPƃ M Mt 9uE1j^ {uHPCPCPe t,GEujCP۠PCPFPh5KSVkJÃuuFPh50e[^_]ÍUWVSuDž22f2fD|1E PE P ÃutS螤u1jSPD ;u/E PE P ǃuVUR~v'E t.jh4Ph uDžE PE P> U t:u DžDžj!WEluVf5f5j@Wluh5PEgWP5gt&'WPcjRHÃvƅCPVfh5VfCPVfu!{tjP谊tkP^APCP tOVP`t;ujCP.PWCPBPh51ISRGÃ(PBPh6H uBPWh"6H[^_]Ít&'UWVSEEEDž|22f2fD|_h@EEE PE P à u]tS蓡u]1jSEP;E }uE PE P EuE4U:-uEE4t&E th4Pu Dž|jUR2FǃWUxUpvhh2xRGPGPh3xR|u"tjUP>P>PGP^ EPUREhh2GPpREPttj@EPxhChh2jƃ(S.PtRhI6FPVEP>Mhh2pR(WURDǃhh2}W{ }1ۋUBPhS6Kut\hh2FPWD+bC9]}3D+EPEPUBPhn6E1hh2W6uD+Et18t,PEPUBPhn6~Ehh2EPEP"'UBPURh}6諔d[^_]Í&'U WVSEE22f2fD|1E PE P ÃutSu1jSEPE uE PE Pǃu 4t?#ujj jW^Ej*WfuE@Ph2hYW-}tjM0t?9Uu3{ u.CPMIQh6CC 1҃ &'Bu<=E1E0MMWCPuCPWut?{ u9hh2CPMQ1hh2h3EPC EF }tVh‹Eљu;EPVjb RMIQh6Bhh2EP819Ut't#RVjbRMIQh6Bh h2EP }u Wh6Ēe[^_]Ív'UWVSEE22f2fD|E PE PÃu]tSku]1jt޿4t1PEPà th}u5E PE PHEuURh6u;&'E t8ujURYPURCPh6cAe[^_]É'U$WVSuEEEE22f2fD|>E PE PÃu]tS:u]1jSEPE h}th+4UR%E}u:E PE P Eu#VEu6P@tt&'U Ut :uEjUR>ǃdUU܋GPUR_/Eh]h2GPEPEPmj@VaCSVGP"PGPUBPh6?8EujGPwPGPUBPh6~?E}tbh&4URuMEUBPSVGPh4URjjEPj(hkh2URf&t&}tjhSVh4W P~ hnh2EP( WUR[=ǃ}ul}tBu&4t/3}t(+4!&4'/3PURUBPh 7h[UR'e[^_]ÉUWVSu1EE22f2fD|E PE P|ÃutS7u1jSEPE Ju.E PE PǃuVh7mq &E jUR<ƃUUvFPWurEhh2FPURMEPkj@S^@PSFPkPFPUBPh6<8hh2UR/E VUR_;ƃf}uTj!W|^t-j@Wm^tWUBPh6<"v'WUBPh7h[W&e[^_]Í&'U WVSEE22f2fD|U :E PR|Ã;#u"S<thh2SEt&hh2SEPU t.:t)}t#E PRhh2SEPjEPEP腹ƃ h0uFPh7聋^h*7h27hU4h87h@7hB7jTt jj[YP蒭Ph20Ut)CPREPCPt|CPCuPN0PCPFPWhQ7jTtFCPCuP0PCPFPWha7jXP֬Ph2;$GIhh2EPZhh2EPGt&Et Php79e[^_]Ít&UWVSE1ۡE 2 2f 2f D|}jEPMQ芷E 0u"EPh7脉 UuEx WM Qaƒhh2E@PVhh2h3VCMA h‰؉љu5EPSjbRMQh68hh2V1ۃEEGFUt$t RSjbZREPh6F8M0MtyvUz tdBPE0P3@‰UtFh h2BPDh h2EP.h h2EPE$]uhh2EPe[^_]Í'UWVS22f2fD|jjEPkƃ 0uFPh7gh*7h27hU4h87h@7hB7jPt jjKUP肩Ph20CPCuPn,PCPFPWhQ7j5PtFCPCuP8,PCPFPWha7jTPPh2[$GyjjFPh~hz7e[^_]ÍUSM U22f2fD|0ҡ)$0&Ђtt&dt&Tt&Dt&4t&$t&Qh7h}'tVtAt,t7uB7;7.'7'7'7Rh7谄]]É'UU M22f2fD|PttQP ]Ðt&Qh7g]ÐUWVSU 1EPRhSO0҉߈щH=vƅ ƅ}ujS0Ph9襂!v߈щNjVSEPzO[^_]ÍvUWVSU GEPRhW]Nt?S9Ut/t*C t"<uj0HPVROuÍ[^_]ÉUWVSU GEPRhVMtsK u4S9Ut4t't"{Htj0щHPVR+t&E9Cu'{Lt!j0щHPVCPLNu[^_]Í&'UWVS} 1:?1EG{C %uLWP)PP)PjPp)Ph9CPC E PSWh;BP|1e[^_]UWVSu::f:f: D|[] SE PSE PËE PSWE PSWh;V1e[^_]Í&'UWVSE::f:f: D|mE PE Pƃu$1QE PURDE7'=8t%01ۋ0PVt|uEe[^_]Ðt&UWVSu] SE PSE PjSWh;V$WSh;Vh <WSj8Ph;h;\Ph9w1e[^_]Ðt&UWVSu] SE PSE PSWh9<V WShE<Vhl<WSj18Ph;h;ޚPh9Cw1e[^_]Í&UWVS} 1Gv{ ut{HtnFu0h<h<h<WPPh<URCPPPCPWPoPh<URu1e[^_]Ð&UWVS}hh:u VE PPEj@PIÃu5PPEPh<hh:EPQ]VE PáPPS-u&E jj jP@PEPW t&E PSEPh<W<hh:EP1e[^_]Ív'UWVShh:u VE PPEj@PHÃu5PPEPh< hh:EPT]VE PVE PxjEPURE PSWEPh<UR_4hh:EP1e[^_]Í'UWVS}1GtQv{ uB{Ht{t8{ u2jWPPFPURhr=CPEu}u"Wh=URjUR%1e[^_]É'UWVS}1Gtfv{ uW{HtQFuh<h<h<h=W\Cu=PPPCPh=W.u1e[^_]É'UWVS}jW_5Gt 9~t6uGtJvC t9t5{t/<u+jU RPPFPWhf:CPu1e[^_]Ðt&UWVS}] SE PSE Pj@VDÃt]PPCP uAj:VCtE Ph=jj jV2<P E Ph=W1e[^_]Ðt&UWVS] SE PJSE P>NjM MjjjjjWhs9qÃ,thMQVh=CPuMQCPVh=CP~$C t'C!CPS(E PWVh&>MQ1e[^_]UWVS}::f:f: D|f] SE PDSE P8jjjjjVhs9q~,t*xHt$U ue:RSh5>@PhE PSVhB>W1e[^_]ÍvUWVS::f:f: D|vE PE Phxh:PTEj@PAǃtG}5GtU9Vt6uGtpC %=uEPCPtuׅtCC to{tiE PuP"PFPh:CP<9&E PuPPFPEPhT>URhh:EP;1e[^_] UWVSE PE PJE::f:f: D|jjjjjMQhs9I|NjG$tM9KtuPPMQ  E t8u{: &ƅu*VMQPPh&>MQvVtCPPhi>GPVGPt Ct&PUPh>GP$G t'G!GPW=~)t&'h>'h>MQ1e[^_]ÍUWVSu} ::f:f: D|Gt 9ptu{~XWSh>V/WSh>V1e[^_]ÍUWVS::f:f: D|E PE Pǃh>MQ =@tM@1PHPh>MQuh?MQF;uh?MQh ?MQ P Ph?MQxv1=@tE@WPt F;u@tLPSHPh'?,W Pdu- P P Ph7?MQt&'WhF?MQ1e[^_]Ðt&UE PE P@¡::f:f: D|E PRh`?i1]ÍvUE PE P¡::f:f: D|E PRh`? 1]ÍvUVSu] ::f:f: D|juOv'S Pu Php?&' Phy?V]1e[^]ÉUVSuGt^9ruKzHuEBHBPBPPPh.:St9SVh?V&u1[^]ÍUWVS}Gt]9{uK{HtECHCPCPPKPh.:V8VWCPh?CPSu1[^_]Ít&'UWVSEPEPjj jP32E}t4Ut+} t%r: tU RP"tU Rh?URt&U RjGtFCt9U RPu({ u"{uUBPBPh<CPuU Rh?DU Rh?6U Rh.@URDe[^_]Ív'UVSuj,U t!:tE PRmPVhK@hPk1e[^]Ív'UVSuE Gtv9stutus't<8t7hQ@PuCL+CL&{LƒSLCLPPhU@V 1e[^]ÐUSE] tB;t==<t4Shf@Px =<t h{jS1t&']]Ít&UVS]u Vht@SVhf@S=<t h{jV1e[^]ÐUWVS] SE PSE PEu4jj{}'E PURb&'8t'1vWP#t 8uWjjj!sPJ PhXDce[^_]ÉU WVSu EhhqDUR]SEESPtjhxD@P t hWvjhV8PURluh+&jURhUR%uh t&'= uhuj"t2jh|D8Ph|D;t@ uht&EPEPǃu:hURUR h'hqDEP1n'UU 8t% 1PW_t 8u㡨P PURh~Dh,hqDEPEe[^_]ÐUWVS}U t{:tvE PR1Ƌ tRCPV֎uut5C(S$PRC PCPCPPCPWhDI&WhD51e[^_]É'UWVS1 }ƅþURCP/u'GjhDVPhPFut'jS)SWURhD&URh!Er1[^_]ÍvU WVS}1EEE1EE?Tu} t M 9t=hAWRu hFE{t&hlAW5uohkE^&hAWuhE>&hAWuhE&hJAWuhEhfEOD1&jA9Ej@/EEPEPÃ^ Mp(DBuCt9DBt/}#uC5 CvFPS6u6u!}M9 4I}tbM9 |Wjjj!\P3PhE^}MQjjj!,P PhFe^VWM Q-EF PFPFPFPFPWh#FM Qh+Fj(4FPPFPFPhCFM QhCFhAW5thAW#u EF t&MFPjjj!oPF PhWF](hhqDFP]SEESPtk8tdPM Qh~FEPhAWthAWu EPW袇 EPWքEPEPu EVJNF PFPBRFPFPWh#FM Qh+Fje'('= tGp(DBuCt0DBt&jjj!;PPhFw\bSM Qh~FEPhAWthAWuEPW蟆'EPWƃEhhqDEP=E &'}t)MQjjj!{PR PhF[ hhqDEPhhqDEPEEe[^_]Ít&'UUE PRhA1]Ðt&UUE PRhA1]Ðt&UUE PRhJA1]Ðt&UUE PRhA1]Ðt&UUE PRhlAk1]Ðt&U WVS}EEEEEEjAcEj@YEvEPEPÃut4t.< w-t+uF< wEPEPE5 =FPSRu6uF,tv}tMQP*t_F}uFPM QFPjjj!kPB} PhFYFPM QhF  v'}4IE)9F 9U}twM9 |l}tFM QMQjjj!P| Ph*GYMQM QhEG t&M QhG 'VWM Q'EEF PFPFPFPFPW8PM Qh+Fj4#4FPPFPFPhCFM QhCFhAWt>hAWt,hJAWMFuG&'EFRjjj!迵P{ PhWFW(h+hqDFP]SEESPQ8PM Qh~FEP(hAWthlAWuEPW*2&hJAWuEPW4 EPW趁EPEPg VJNF PFPBRFPFPW8PM Qh+Fj!(%&'}uM QhGEhAhqDEPE $t&}t?M QMQjjj!7Pz Ph*GpVMQM QhHNhIhqDEPhJhqDEPu1e[^_]É'UUE PRhA;1]Ðt&UUE PRhJA1]Ðt&UUE PRhlA1]Ðt&UUE PRhA1]Ðt&UUE PRhA1]Ðt&UWVSu1lIRhIRh[HUR&\IRXIRh[HUR& TIRPIRh[HUR&LIRHIRh[H`Ra&  R Rh[H@R?& O'@R R`RURURURj@`P RjANPjAC+4IR RRPVhBhiHj @RPVhH jAtMjAֱPjAα+4IR RfP RVhH-t&' R4P RVhH4C v(1SQ,$I$hI$t&1SQ,$I$h IUR$4S RSRS RSRSRVhBh*Ij $t@S u@IR4QRfP4SRURSRVhOI4Qt2RVhBhIj2t4SRVhIv G4 4tz@R R`RURURURj@P RjAPjA+4IR RRPVhBhiHj ~1([^_] U WVSU :E PR& 8 1PPƒt s 8u P VEPhIq 8t@ֻ PhIhR0щT 8uȍPEPhI1[^_]ÍUSU= u-jjj!2P tPhInP't\:tWEE u@PRh~F]SEPjhhqDSY$jj=,t&'jj'jjh@hhI1]]ÍU,WVS= u.jjj!cP:sPhIOv'U}WRPE [ M}܉}ԉ9CuEhhqDSR}W<U܉U؃t3vU܀:t(}WRPVFSRSRhJN}uh hqDURt&rjjh3JBrPhdJN S 1QR,$JfEu 5JsJfEu5J\v'JfEu5J ]GWVnuE@PV蠕}tEU vE hhqDEPhhqDEP說hhqDEP蔪$hhqDEP~E JvUUh,v tpCPhvMV CPC PhzMVz Cu{PhvMV_ C,u{PCPC PCPhMV8 GuVEPWPWjjj!Pa PhM/>h<hqDEP\1e[^_]UWVSEE1EEuMMPhXM]SUEPlEhPhqDShMEP ǃ$EPjjj!?Pa Ph_Mx=hU&'jjj!P`PhMA=hqhqDEPk hrhqDEPUWg v' 'uEuh\hqDEPh]hqDh蝦EMMWhEP EEhahqDj0_‰U  BjEPhdhqDEPEPW$WhEP}jEP誵j EP ChlhqDEPE P,tСp(DPjj jSƒEPWhEPjEP2E8th{hqDPEP蠦WhEPjEPMQEPtP)‹EPMQEPtP‹EP MQEP蜮MQEP菮tP‹EPEt 8thhqDP;‹EP, EH  t  EW MQPMQjjj!1P^ PhMj: Ph蚘 hhqDEP脤1e[^_]Ð&UXWVSE EEEEEhhqDPQEEhhqDh跣EhhqDj0裣,$vEPEP+Ã>j/S.ǃtGhhqDShhqDhM躧E EPEP hhqDEPmbVW8tX SWtSEPhNEPN }thhqDh NEP腤hhqDEPEPkUEPRj1 fEf%f=@d,MH @M H&,x!jjj!P[PhN28hhqDEP_ hhqDEPIhhqDEP6hhqDEP#$hhqDh,oEPjjj!aP8[ PhM7hhqDEPǡhhqDEP贡$hhqDEP螡hhqDEP苡hhqDh,&hhqD0}P,B  JBQh$EP,@P Ph.N]S>(jjh@hEPthhqDEPѠ hhqDEP軠hhqDEP訠hhqDS蘠e[^_]Í&'UE tN8tIhhqDP,P(,BPBPjjj!诓PY PhIN5]Ít&UWVSU 1Eh hqDR, R tӋut,&', ,J v(1QR,$N$hK,'1QR,$N$hKURlUR,zRdP ,QRQRjjj!wPNX PhiN4 RhN]S$jjh@hURQh!hqDS豞e[^_]Í&UVS U1E tu0jjj!PWPhN!4<* UUUEh5hqD Rh6hqDEPh7hqDEP$h8hqDE,PНh9hqDEP轝EEu  jh萑jjj!PVPhN13U :nE PR芦jj jPÅ2jjj!藐PnVPhN2t&' E9X9 t U v hUhqDE P賜hVhqDEP蝜hWhqDEP臜$hXhqDE,PnE@ ) hZhqDEPO  Ph9 Sjjj!蚏PqU PhO1F 'EE} t2 EtGEpFEu4&'E Pjjj!PT Ph=OJ1e[^]ÐUWVSu1t~u+jjj!ЎPTPhZO 11t& ÐCPUR#xCPFP ud tURPtjCPURhOjURFPjjj!.PT PhOg016fhhqDj$%hhqDURCP<hhqDFPCP%,hhqDF PCP jCFC C hhqDU R0CF  tNjut &  URFP Pjjj!+PS PhOd/ tURP莧thhqDURh ?e[^_]US EEE=4ItjA赌94IE@ PJPUB PBPjjj!cP:R PhP.hhqDE@PEP蒙EEEH (9 AA 8PE@Ph~FEP葞E@tthAP9thlAE@P!uEPE@PzUC&hJAE@PuEPE@PxEPjWEPEP:hhqDEP藗U hhqDRzhhqDEPd$hhqDEPKhhqDEP8hhqDEP% ]]ÉUE t8tjjP   fE@ti$jjj!8PP Ph?Pq,h7uFjjj!POPh`PA,]Í'  ]ÍUS]Ejjj!褉P{OPhPEP\t;tSjvjjh@h EPyhhqDEPӕ1]]Ív'UE t8tjj jP  @ t8<Pjjj!PN PhP+]É' ]ÉUS]Ejjj!蔈PkNPhPEPLt;tSj8vjjh@hpEPihhqDEPÔ1]]Ív'US] ;t,S4th hqDSh J<*jÃhhqDh -CC( tthhqDCPh t;thhqDhDh Su/&h'hhqDh 蜓 t Pjjj!PL PhP2jjj!ՆPLPjjj!PL PhQ(]]ÉUEt8tPjin& t'Pjjj!kPBL PhEQ9&jjj!EPLPjjj!0PL PhfQi(1]ÍvU= tQ= tHj+ 9 }. = tj P]Ðj P] USM] tBt> t09tBut!hIhqDSP轒.t&'Qjjj!DPK PhQ}']]ÍUSM] tBt> t09tBut!h\hqDS P=.t&'Qjjj!ĄPJ PhQ&]]ÍUU t tRP ]Ð&UU t tRP6 ]Ð&US1EE PE Ptjj jPÃE t8tPSX] Sjjj!ރPI PhQ]S蓖jjh@hEP̣$hhqDS)]]ÉUS1EE PE PCtjj jP(ÃE t8tPS(] Sjjj!.PI PhQ]Sjjh@h0EP$hhqDSy]]ÉUS]E= u1tjjj!赂PHPhQEPmt;tSjIt&jjh@h`EP艢hhqDEP]]Í&US]E= u1tjjj!PGPhQEP͔t;tSjYt&jjh@hEPhhqDEPC]]Í&UEt8t= ƒ 'R= t RPjjj!]P4G Ph/R#1]UEt8t= ƒ  PPjjj!PF PhXR>#1]Ð&UPS  PRhsR]SvjhyRFPhdJ" jhRxFPhdJ"jhSaFPhdJ" P P P'R= tSP PhShSFPhdJ}"$jhTEPhdJc"jh`TEPhdJL" uTPhdJhTEPhdJ "jhTEPhdJ "$ P{P PoPhIUhSUlEPhdJ!j"PDP UfE@tRhIUhU'EPhdJ!hqDEP31]]ÐUWVSEE}0щȃ$)ĉEPS0щMT :t: u J:uj S*ƒt$SE Ph W}WӍEP\ƒjj jRQƒօ*j1hWW]jSE PhWW苍 EP\‰Uj4hWEP*} tj6hWh{EP܇EPh Wj1Iƒ tEPhT|h#W 9}wWSE PhWEPEP\‰U RSh=Wj0ƒ(tjEP?Ph W; jBhWEPb G9|jDhWEPJ/&EPh Wj1ƒ tEPhCW Ee[^_]ÍUWVS} = tsEjMyPh W]ShQWSSƃuj_hWS譅St&'jbhWS蓅 jVAVt?uURURjW8e[^_]Í&'UWVSDžDžDž1URhS 0ƄURKuURhS ΍v'< hhWRrhhWP\hhWSR(j Pt$SjPU RhSWRFPYhhWR(URhS 0Ƅ8 SVFPU RhSWR謉P@YURhSY(0ƄhhWR  URq8t&1[^_]ÐUShjh}hyh:oheh=[hQhG h{:h0hҦ&hh{hth˨h/ hhhghϪh7h{]]Ð&UjjD]UWVEU t18t,t(p tp uRhu vRjx6e^_] UVSu] SE P苊t$jPh`P膱SE Piu Vhe[^]ÍUE Ut8tPj薱]ÉRhe]ÐUUM t:u!]ÍEPQRhtjh!yM]Ðt&UWVSu }0}HE= !tv1= !t?u= !URGPURw uuu"t0{H9Eu봍1e[^_]Í&'UWV}ff D|E PE P襈ƒtLu jPh{jPRh@ h@hA Whe^_]ÍUU Mff D|*:t,j2RhOhh]ÍQh]ÐUE P9Eh8hEPK~]Í&UE P8Eh?hEP~]Í&UE PA6Eff D|FhGhEP}]ÐUE PA7Eff D|NhOhEPU}]ÐUWVS]u }ff D|ThSth\Su_|t6Ph$P@P|PhH_v'WS)h_hh||wtl>tghehVh|2}j |PtPP|Phu|Ph'WSe[^_] Ux ]Ít&UVS]uEff D|y;hSyur1ۡ$!A'u hìUBu{PBPhάC EEuh֬ v'E t8uVS}&;h\SĈE P@Ph$!uE xta@PhshhEPmzhhEPWz hhEPAz>Ph$!"jE Ph$!PE ] SE P5SE P)hhjvyEV?PhEP,t ;thhS}‹EP E@@ Ph$! ~lAA(tPMA…u{R{t{RAPh UBu{PBPh访e[^]Ðt&US]Mff D|U := E PRŁá!Ph(# PShS=tm PShbjZtS PP諶PSjPhhhPS1Ph  QSy]]ÉUS] ff D|=uht}&hj%t.PjPhh0Ph PhحjEPܭt;tPPzň0jh{EPj让]]Í&UWVS11ff D|E PE PÃtzjhS݄ tjhCSȄ u뺍v'jh']S裄 u 땐t&URhzv't VVt&tjjj jj e[^_]ÍvUVSUEff D|E 8uE PE P~ÃE t/8t*PTtxjE PV: uc&jjV9 tJtHP,хuiQitQ@PShEP謻dt&RhUe[^]ÍUWVSuPro5<= BUU{h!ht&h k{9{|o5<= UBUe[^_]Ð&US]U ff D|G{t:tPPPSh5]]Í&'UVSU1E1ۡff D|TthlRuuTU tE PR3|ƃjt P8PEP7à tUCPhEP船AE PP(tCPhEPN ue[^]ÍUS1ɡEff D|lU t:tE PRC{jQEP6à t:C,PCPh'EP裸CPh5EP葸CPhHEP]]Ð&UWVS}11ۡEff D|U t:tE PR|zƃtV=t] 1jVEP5 t/uWMQ'SSSS@Ph[EP誷e[^_]U(WVS]EEEEEEE1EE1ff D|huS8~h{S"~hS ~hS}hS}hS}EvU :E PRxS t r&tg}taEvt&EPEPShjdEP/t&jPSh-jdEPjh{EPUR@x[^_]ÍvUWVSff D|E PE P7pÃt޿ u%jÃujtÃu{ujh{h9j _&jjSPh'YSjPhhuPPh,h'YSjjjhLx'e[^_]Í&'UWVSff D|E PE PoÃt޿ ujÃu{ujh{h9j g&hhxhjSPhsSjPhh]PPh0h}SjjjhL`&e[^_]ÍUWVSuff D|E PE PnÃ޿ uj;Ãu{E PE PmǃtW3jP]ƃ uhgU t:tRhVSPjVSPvE u{Pu'YPSj肺PhhhP&Ph u'YPSjjjhL$'Vh%e[^_]Ít&'UU Mff D|:tRhj2]Ít&'Qhį]ÐUU ff D|:tR]Ðt&jj'T]ÍvU塨P"PhɯG]ÍvUWVSEE1Eff D|E{E t8uhԯ J&U UURE P;kǃX} } U <-ttff D| >{h hh|Ah hh$|Ah hh |A$h hh|Ah hh(|Ah hh,|nA$U UURE PJÃSDGE<-tSK u {Y'jh@S u {,jhBS uLURE PIà { h hSh$|A5$|&jhES蛤 u {jhHS{ u {'jhJSK uLURE PHÃ2 {@h hSh |f@5 |$&jhLS uLURE PHà {h hSh|@5|&jhaS苣 uLURE P?HÃr {h hSh,|?5,|at&jhOS+ uLURE PGà {h hSh(|C?5(|t&jhRSˢ  {URE PtGÃh hSh|>v'޿ ujƃt8>0p-e'}tJjƃt>uPf&VhT5QvURUR?u{ts1{toPu{PhXhwe[^_]Ð&U塲ff D|E jE PPfjP]Ðt&UU ff D| ttС)tV@PovjjVjjjP貎e[^_]Ð&US]U ff D| toti PjΓPuPjPhhhWPPhSj(h ]]ÍUWVSU =1ۡff D| t:t"P%uPƃt>uX Gt&Q t BvuCy uC u܅tjjVhP9h/If=Vhh@h< PjzPtPj薌PhhhP:PhVje[^_]ÉU塲ff D|3 jd )t jhRe khuV]ÉUVSu] Uff D|> t;uRV蜯sv'j j跔SVhz{h@PKptShSh j@P0sPjhČjjWe[^]Í&'UWVS]}ff D|T E PE Pq=ƒu!!uqh&пu u;hLt&п ujԍƒu{jPSE PRWS e[^_] USff D|s E PE PY<ƒt(:=u#E PBP]]ÐUWVSE=8Xul} tfu vU <-t=>uVWhbjT'ƒtMQMQMQVW >e[^_]Ðt&UWVSDž`T}4 󥡲ff D| h>Eh1Eh$EhEh EhE>tEU@>h# hMQ'Xh X|MPj,|PXt X|T%uO|PtÃuh jU RSn  } M 9-uQ@PPt&"uU Rhmit&/uKjM Qh{P&xh{jPwhE hxPq"(i'=Džt@P&uO|@PBu;|@P^u'|@PhҸŹ'|P}ƃt+hQ hU R%tVPKxhU hM Q%x |@PWtPURtuxPxP|@P }tijh|PQ'|@P#tMQxP|@P URxP|@Px  he hxP hf htP t&'Džp= th蓶kt&'hq hM Qm$p|PKÃu}tjh|P = u}tu|pu|P{ƃWPDPR\dPDP|PeVpP(}x}pP|PhbPDPtapP|PP]PjuPhh1P|Zu2P!PXPh轴 xP|PPD Pheh hxPh hpP(dQ'[ P<t h hhPPh h|PPPP|uU Th hpP X|d1ۍULL1Džl|>D>PIZdD>PLP`}h hD>P!l|Ht&`tPMQRh( dDž`}tjD>PLPhdh hD>Ph tutjP>Pv\jwHtSjPHQ t8jPP*[PQa t@tt&Dž\}D>PLPhbD>P|\t;lPPZP>PjrPhhD>9t&'lPP~ZP>PjrPhhD>P,Ph葱 u:h hEPh!lPEPjjj hx(:Cw0lPPYPjLPj hh hlPBD>PLPD> Phah hLQD>(dRWjjz L C}t;@PtUt&jFtjjh{hjZ h hhPT  ><[^_]ÉUWVSu E1ۡff D| }j4tǃU :-Bt&'E PR"E Pt&'E PR"E PE t&jqj rÃEEPS蒘ƒt9Etu,BPjEuPB P !PB^&heS&*h vS&h1sS&h|pS&ujjh|p&'jh>S& u,jjEuPhXjhDSs& ujjEuPj{hqS%ujjEuPjY,Mt&hbS%ujjEuPj9/t&jjjEuPWh(hEPde[^_]Ív'UWVSEjsơff D|0 MFF(t=}h6hCPW8;th8hhWuƉ5EtjjjM QPh=hEP_M t&hJ6e[^_]ÍU,WVSDžDžDžDžDžDžfdfff D|_h`hPPTPPÃj,ƃudPV}CtkPV}t*11DžDžCI t*PhfT}t1DžCSptPSܛtPSBPS蜓t2}؉8uDžsuwPPPhhhStShhP(hhPj޹1t#utPPzuVPP{uPPhphSsS# jIƅqhzƅ119~{Džh PW"hhW"Cu'WhhPh=ƅ1ۃF9t$PhhPh= !t hƅ1ۋ5 !t]hFPW!hhW!Cu'Whh Ph腧ƅ1ۃ6ut$PhhPhNhdƅ119hPW!hhW!Cu'WhhfPh˦ƅ1ۃhhP F90HvShhPhchhP h`ƅ119hPW hhW Cu'WhhbPhǥƅ1ۃhhP F90HvShhPh_hhP u腱hhP_[^_]ÉUX]Ít&UWVS] uEEEff D| MQ轛0Ѓ$)ĉeSPon;ujh{h{j<ft&vj{EPEMQMQVPMQ= t = u$= t = u= t>= t5ED;t<v<v t uEEEt8uʋE8{NU:}EPEPVRE}u'}t!}ut>tVhEPa VMQEPPhIhEPM = t = = t = = t = E8 = jMQEP hŹ6vt&hѹEP t @E EVMQS^ = t = u+= t = u= t = u]u e[^_] ULWVSuE1E>wjCltV>PhԹ脣 >j,$EăuEd0Ѓ$)ĉeVMQ7kMQ֚ MjJEȃ>tKv>^u#} tt}t9E$v'PMQst CF>u}u u} t7u3j-|u%jh{Vjv&'E8'u(j-Atjh{FPj8`vU<@t<(<(uj)j(FP^+ tEPMQFP#E thhEP6  } zmMQS^h{ REEEff D|j R%rEtEt&'E{EP@EPEPEPWE }t{}}u} ttMQ}]h{3 jjMQMQEP  hhEP ;v'E8!MQ@P^EtO=>uP谶jٮt&MQjP hhEP~'h{f&'}ؾ󥤃} ttMQg\h{EPEP=ǍEPEP~ƃt}|}}ff D|*FPh0OgVt=FPMQMQF P !P҃Ft,Ph &'FPh20hvEԅ| }ucu^G t=uEPh Wt)GPMQMQGP҃ Phv}uZ}uPEP@mt }u;}u5 jjMQMQEP:  PDPEPK u$jh{MQj_v'ff D|N E@PRBu* 8Ph{&EEԃjIt#MQEPhb!L tu8tpEPwtu PhEjIt"MQhKD EEԃ~EPhKכEPEPhb辛 }thxhEP jJ89Et jJ) M̉  >1e[^_]UWVS5 tZv>R>Pha }u3Nx0>v>PDPh辛 Nye[^_]Ít&'U t@>]Ív1]Ív'U t@>D]ø]Í&UD(WVSDžDžDžDžDžDžff D|hhuhљ X  u jQj h˺蕙J j#ZU :E PR ƃ0HPhV uDž}v'VZuVhrMv'SSMuhhEt&}tJ];WuBPhqSgh hSY DžDžDžDž @>ǀ>vSh(Va q 'F<v<v t t<#0Ѝxb~|>\ta'YS()PD>P[a t90Ѝx @>|> ~|>\t|> mD>c&'>ThWt9t y\uyݐtDž&t 9u >/uyjju,jk1ҋt{ 'U RPjh]hS :'u*h`hhSVu2hihVS;/t3&'{}}'t79cy*YDžDž6y*uJj.}t9u,Dž @>&hhhdSyjju2jk1ҋt{ U RPjhhSDž 'Dž+Džu @>9uhhhv&hhh[gu: @>PPh蓖 )t&u Džhhh:S=y%'yyupjju#jk1ҋt {U RPjhhS 1'hhhS_Džq,&uhhVS 1 @>{ tSPh<ߔ t&SPhr讔 N'jju#jk1҅t{U RPjhhS hhSS_U t :)jJt jP [^_]É'UWVS} ff D|5jjjkp1҅t{RWjj5e[^_]ÍU塲ff D|jjj<jh{h{ji]Ðt&USff D|ƅE PE P,tbP? tBP[tt(P2XPh蟎 h$hP hvhS:^ShW]Í'UWVSMU }uff D|0RQhbhSWVWSj3[^_]ÍvUWVS}ff D|9E PE Pƃ] ;ShjVjzh2EhVSVhbjXyV,tBSVP4PjLPhhh[P>Ph裋 URg2WU! tE Whһ>pe[^_]Ít&UWVS}ff D|Y} U :1ۅujkOhЄW%uG}x tZunh6kWuN9MÅuWEuV9t7Et(Xt&'jIMÃU RhjSjxhS.Th0ƃ U RShbjXTPhۻ\t.U RSP2PjJPhhj/U RSPp2PjuJPhhhXPPh~ VE0jjlSv'URu޻Pne[^_]ÐUUff D|jjE u{PRj]Í&UWVSE M= M8X} u U <-t|SVUREPW^'WhO|vSh__e[^_]Ít&'UWVSu}EMQUD|U :E PRS謄 u t ;*E 8jPhH2E =HttS@Pu{hhMj EhhMSPhhME PEP,EPhHh1UBPBPhnz&'SE PhzhhMPEP\EPhHN2‰UtbBPBPhPzhhMEPJhhMEP4$hhMEP 'EPhտyhhMEPv'WueP^]e[^_]Ít&USMQUD|=HtKhhh7xH t4CPCPhx ut&'h&y]] UWVS}1MQUD|=Ht=hT|h3W\EH t vCPCPhFW9EFutVhUjUA t Vhatxe[^_]Ív'U WVSUMQUD|RjRMQ ƃ ~ vDžDžDžDžDžhjSFMQUD|\h^hMF PP_h_hMM QPE,PRPPt8&PM QHƒ&5p(. x(&5|( t(Ct&5d(Ct E PE P3r&Dž^t&C h(t`U t):t$E jj PR;t&'Džt  !G?q$h*hMPSt:9t/h-hMhS`h.hMVSI ~>h2hMhS"h3hMQ PS 8tTh7hMP P*~(~PPAPhoFPhn&hnH;?hS)U :E PRǃth<*tdjPWf t9hKhM P`F$FPh 5n$Wh%nt|tv<*ur PP(t7hUhM PA$ 1uh4mt&MQS6QDž95~l1ۉ(t8A uSPFPhX5m uʁl95[^_] UWVS11MQUD|lE PE Pt2p(DPtjj jQo6ȉčtV0Ѝxt?~:F4v' )PjqPPuPhgKҍe[^_]Ð&UWVSMQUD|E t8uURURYOt&} WPÃE t:8t5S诚VtWE PÃt&'j.ƃjPV6ƃ tU;t hqS5uFEt&t,;t'jhtSj uFv'URURsNFPPFPhwje[^_]Í&'UWVS}uE PE PEEEMQUD|t;uPÃ;Sh载ShiPlPStPPS u%jEP8SEPEPhg\t&jBBdPA8SP=Ph'VWLe[^_] UWVS}] uMQUD|tO;tJhqSup?,hStVWWLzt&p?=p?t-jj5jjSp?+ jj5wjjSnp?p?PPh;he[^_]ÐUSE t 8)jhmPh^fjPEPj5P4Pj yP Ph]hfPh^f4jrHPPjS:PPh#PPh]hljPh^,f$hPPjRPPj8PtPh]hPqPh^e$jpPFPjEP5PjzP!Ph]hPh^e$hFPPj68PPj$PPh]h:ȈPh^-e$hPPhPPj(PrPh]hoPh^d$hPAPjP0PjzuPPh]h$Ph^~d$j D%PPh&PPjYPPh]h趇Ph^d j PPjPzPj%P\Ph]hYPh^c$jtP.Pj=vPPjbP Ph]hPh^kc$jf1PPh PPjW PPh]h谆Ph^c$hPPjKPqPhehknPh^b &'E PE P3à jhS9 uBj [%Pj j ?PPh^h 'jh S uLh%PhZhPPh^h2 v'jh8S uVRqt?tPhW F~hhMPW,@?(@vhhMS谭 9~Sh蕻uNjfRE P跶 t hqPeu &1Pjf^'Sh5u^jW跠RE PW t hqPu &1PjW&'Shźu>,@?(@hhMS蘬 9~'Shuf1?UP^ShhePh^Aރ~'t&'jW詟PSPjf蛟PBPheh?ePh^A[^_]Í&UjhePh^vAPPhvh|dPh^PA( PPhvhdPh^'A(P$PhvhdPh^A08P4PhvhZsdPh^@@P<PhvhMdPh^@0LPDPhvh$dPh^@XPHPhvh8cPh^c@0TPPPhvhcPh^:@0P,PhvhcPh^@]UWVSE} u{9'þ ,;tPWuFC;u ,e[^_]ÍU@WVS]EEffE}̾ U t uSh42$e'-u;jj 2h:h@h!hMh0|d' EE PRÃ;d0҉߈jPщHEhhP}W {}~R]ShPPWf }~OjjuVE*jShPOPEP* E*VEP uhVW uVhPPEP~ u,{}~{RVhPPEP }jjuV E*jEPhPPEP E*VEP uZh>hMVEPBA'{} tRSEP腬 E PE PŰÃűEPj !jEPPhKhMEPJj 賚PhV(>e[^_]Í&'U(Uj2j2j2 jjjj跡]ÍvUVSU t:uo1jjh(ƃ ujjht_Ph^S<FPh^B<CjVh(1ƃ uYE PR>';t>jjh(Sƃujh(S E PE PVÃue[^]ÐUVS]u Sh8@Et6j5hPͥj6hEP躥j7hEP誥$j9hj 9Ej:hSPUj;hVEPA,EPh8@e[^]Í&UEjjPh8@xEu]Ðt&jIhPjJhEPjKhEP1]Í&UE=8@u1]Ít&'jjPh8@t܋@]ÍUVS] SE PέƃteSE P軭Ãt"SVkSVh:v'VtVhX:`VhE:Mv=8@t7h-:8@t*CPCPh9 u vh9e[^]Í'UWVS}tW0}Ѝp1E19M ~/UUE]2U0ˆEGC]A9M ً]e[^_]UWVS}tQ0}Ѝp1019M ~+UU؋U2U2U0ÍGEA9M ۋUe[^_]ÍUWVS]u 0HE}tVPSEPS'EPS(VEPW9e[^_]Í'UWVS}] ()jjP* jh(VT ƅ0jSW<$tOhV0Sݱh$PS˱hhS軱$hh$P¡hW0P莱 hh0P赥[^_]Ð&UWVS}] hhhjSWrEt(hPVhhEP)&hWVe[^_]ÐUWVSu}]jV{;tPWMQM QVjXPh"MQ@tRPYPh4K6(jj?e[^_]Ðt&UVSMu UEPRh7QhMhSjSVh[^]ÐUVSuU t$EPRhSjSVhg[^]Ít&'UWVSEEPh[UR8PU RUR?n]SEPèSEP跨Ã1t;tPhb8PhbxƃFPS(EEhhd8PÉ]j@Set @t8uhhdEPȞvP >PSSPhkFPh hdEP莞 }u5j(uUEPUR8PU Rhs7'8PU Rhr8PU RhshR1e[^_]ÍU WVSE]EjhP8PU Rs= = j"St,jhb8Phbv@ h1hdS]SLEESP详ǃu6h7URU R h@]'UU 8t% 1PWt 8u㡨PpPU RhhEhdEPΜ1e[^_]ÉUWVS]SEPSEPޥSEPҥEEPhUR8PU Rs,( E1juVhb8PWuÃuj菏 v'CVP}tVURWhEPt&VWhEPEPjRhdhdEP蟛jj薏Eu{PUR8PU RhQhRHvEPUR8PU RhQREPUR8PU RhQEubPuPuPh蒡1e[^_]Ít&UWVS]PIPS¨ ]SEPEtkSEP֣EtWSEP£ǃtDSEP诣ƃt1SEP蜣jjQ8PSjVWURURU REg1e[^_]É'UWVS1EEPh;UR8PU R]SEP$ƃEt8t SP ǃUR9>tV91t?tPV8PhbrjVEP8^E CVCPqCtPW VtPvPV? tUB,tPVU RhFEPVU RhxEP}VU RhEPgV8PU RhRaVhT|U RhEP(Mj(ًu9}uhT|U RhhT|U Rh'EPEPUR8PU Rh}1e[^_]ÐUWVSu }WhFUR8PVUR7jhb8PhbpÃtjCtcPUPhT|VhM{tnPCPCPhT|VhUR8PVhhV7vj(詊uhT|Vh'WUR8PVh|1e[^_]UWVS] u}WhV8PSjhb8Phbo$t@j+PPhT|Sh,V8PSh*hSDWV8PSh*1e[^_]ÐUWVS1EEPhUR8PU RUR6*]SEP0ƃ>Et8t SPǃWV8PhbojVEPrZwoCCtPWtVptFPPV蔕 t-U RVhEP8PU RhVv'CtPWzVaptZP?PV tAU RVhEPn8PU Rh+hRd Vg'j(ucuPhT|U RhEP;v'j(詇u?uPhT|U RhEPEPUR8PU Rhc1e[^_]Í&UWVSDžEPh1UR8PU RUR3]SEP譜ƃ>Et8tSP脜RV8PhbsljVPWǃCCt<tPRntEPUR8PU Rhv8PU Rh;Stn0thWS-t:@PVhAP4V8PU RhhOR)t&VShT|U RhnPoVhT|U RhPPvj(艅u[uhT|U Rh&'hT|U Rh'PEPUR8PU Rh'1[^_]Ð&UWVS} uEEPPVQ tR`ÃtSMQEtEu,hhdhEPԑ: hhdPVW. PEB hhdEP貐Ee[^_]Ðt&US]j("thhdh{Gv't;uhhdh{#hhdSеP藯PN]]Í&UWVS} u]p;gS+EtjhW`d hcEV/hVtSVWhjjPV tUSV8PWjPh}t&jV8Phbh t Rt&SV8PWjPh }t P@t&hWSVWhj6t7SV8PWj_PhjPHPh4k$$jj_MQ&1e[^_]Ív'U WVS]PPSb ]SEP芗EtqSEPvEt]SEPbEtISEPNǃt6SEP;SEP/¡8PRVWMQMQMQM QZ1e[^_]ÍvUWVS]P)PS袛 ]SEPʖtrSEP蹖Et^SEP襖EtJSEP葖ǃt7SEP~SEPr¡8PRVMQMQWh?M Q!Z1e[^_]Ðt&UWVSj(}W}U:Bt8CPUR賚uCuPCPhjAu11@@PURrt+~C~ދURAPhj U RjL@P@@Phj؉'ƅ1ۍ1vh@@PWڛhhWʛC~ҋBt0hCPV蝛hhV荛u؍PhjU Rj1[^_]ÍUVSu Džtj~tZjsÃjPSe jPV h5VShBvj(y~xS}{Q h~hdh RPhXhXhhPCPPtS,j'}YtRtPhqjVjhhdS1l[^] US] j(}ujLP>Ph4j Sj.1]]Ðt&US] j(B}uh}Ph4j Sj 1]]Ð&UWVSu}]j(|uIWm)u<0HÃtwj,C PthtjPPP htjPPC Pܗ VcPVhPC Phj Wjf 1e[^_]Ív'UWVSE11P'uaUt/:tEPRƃUt:tEPRÃt't#Etu PSM Q赐1e[^_]É'UWVSu1>t|VϬÍUEPRP 9\9]|WV説])j V t@P茬})ǃW<$S$]E$hV1e[^_]Í'U WVSDžjMQE jhM Q8PMQ%=Bu BDžhMQP˕ PSP> j Q8t&Dž{M <$Z<#ujPQW_ =5BtQFPt6u11ۍv@@PQt G~݅uuD@u&M Q %1҅tU RQh&u;M Q$1҅tU RQj MQ t&'M Q$1҅tU RQj MQhwjË BB+ j4w9jVwtCM Q8PMQQjPhj3P6=Ph4$PP RDžvwsQQM QMQ8PQ}TbQQM QMQhjj6vjhb8PhbO\tX{9tPQM Q8PMQjUPh"j(Ev't]!V{9tPQM Q8PMQjPh"j(u&t RVP;Ph4(Dž tQM QMQVF)&QM QMQ@@RP@ЉH@t t6Fu0PP RDžH@u t!FthPP= H@u,F"QQM QMQhjih蔽hMQj6}t{9tPQM Q8PMQj?Ph"jhb8PhbYu(j(tt-&&'j(s(t"RRP9Ph4(jjS謼 hhdP hPPȏv=Bu Bu{'PMQX[^_]ÍvU( WVSDžDžjMQ Et&~ DžjhM Q8PMQ=Bu BMQhPS蚎h?hdP~vPPQ tM <$g<#ujPQEX Jj Qt&'Dž{=BtQGPt?u11v@@PQmt C~݃`u`[T@tLQM QMQ@@P҉t(hPQVhvP t\GtUQM QMQWЉt6hPQhhdP}uPQM QMQ8PQ]QQMQhj,h2hMQRQQ8PMQjPhj%sP5Ph40QQ8PMQjh0h=hj V裸DžhPQ΋ =Bu BPMQu[^_]U塨B]Ít&UWVS}uU=otJEPRSjSv@@Pjh hP(6&'jv@@PjhhPjjBPPM QLV[^_] UVSu 19Mv< t6t`<tjv'< t,<\t8V\BaK&\Bn;&\Br+&\B\&\B0 &BAC9uhhdP(~[^]ÍUWVS}u 1hhd@PlyEE199A\9Aat60t_\th&nt+rt6Tt&\Mt&'=t&' -t&' t&' t&'@C9hEe[^_]ÉUWVS}11v@@PWu &C~׉=Be[^_]ÉUWVSE} UjPÃtICjSƃuC. FhSWhVURe[^_]ÐUEU B]Í&UE UBЉ]Ð&UEU MBʉ]ÍvUWVS]0} ЍPU$)ĉU RVbVd}E ;URPV t\E;u;t[0H9Et,;t$vURPV u U;uߋE$U뤐t&Ue[^_]Ð&UWVS} ]BUBt&';EPSÃtlWURbPSqthB mt&WURt &PUBPUPhjvWURt &PUBPUPhjv;EPSÃSŠuBPhv t&jj jS\}BPh rv'PWURUWUR PUBPB"t&'WURPUBPUPhjPS.Phs e[^_]Í&'UWVS=)xE t:8t5PuE 8*u E PE P}Et&'jE}E PE P}Ã/;-uCE EPShBCE Ettw&Sh Yu P BB(CPMQW^tVMQP uSh MMPBB (tpv]uGPMQ]t 9}h{SP2 C9|?u{tuP BB(uhDt&'FPMQc]t1ۉh{SP C~6uǍe[^_]Í'UVS]h{hhrjeFjeF jeFj eFj/eFx jeFtjpeFPjqeFTjGeFjHeFjEeF jFzeF$jYpeF( juceF,jvYeF0jwOeF4jxEeF8jy;eFt!hhVSp^t&'u{PMDPhhP(Phs7_t&hhS`o W tjPP҃ u"PPh*Mt&'h@6e[^_]ÍU,WVSE MU <*u!E PRxEt|0Ѓ$)ĉeRPAEPEPwEPEu ME0&E PE Pw&' ME PE PZwÃ;-uCE EPShDE Ettv'Sht&} lX 1}uWMQMQZv'E;&M9*tt PMQXtWMQS6F @uE}~t&ShEMMMM] lx 1҃}u3MM9MSMQMQ EM9M|vE|&u]M9*u"9}Zh{SWU} CU9|>t9PMQUWUԅt"9}h{SWU= CU9|B@uE܋=}~t&'lX }u*Evh{PMQE E@0~11xv'M9*u(1h{PSE E@0~>&t2PMQ0Vt!1vh{PSEU E@0~F@uG~uMQhX`e[^_]ÍUVS]hhh0jhhhn^PFPkhhhM^PFHPk,hhh)^PF4P|khhh^PF P[k hhh]PFP7khhh]PFPk hhh]PF@Pjhhh~]PFDPj hhhZ]PFLPjhhh9]PF$Pj hhh]PFz‹EP@P-z‹EPhgh,PWhhhE(PW hihEPWhjhEP}WhkhEdPgW$hlhElPNWhmhEhP8WhnhEpP"W$Et jjЃhqhuVVCv9G=Gtv0IB 0I 9utX,؍e[^]Í&UE/I@IEP(hhEPeVIEuƉ]ÉUWVS}u j=IEGthK ыC~7 ut t u#{$u}tC C~ u=Gu=4It 4Ie[^_] UWVSu]jjS_ fEEEPSFP豼  F!F ǁ~ <fE%PEP&PF IPFPhj.tm=jP&3,P(9PȆP8jjܰMQ裍= Ut Pj6>Ge[^_]Í'UWVSUREPYƃ=GtbG1VP^u@hjDh ƋEPPGjj V.& ;uVhhA Phe[^_]U(WVS]EKM܋ M؃ujR BB$C Ћ4If}^t4wtPt&'t+t69t&8.'''C hjK fC4fC4jjjC4PC0PFPdC}t('fC4fC4CCPpK EPEPCPc Vat4I{ fE%PEP褴PVMQhj跮tb=t4Ft-Vt&ƿ ttRPhQCe[^_] UWVSEE] SE PTEjjhvMQhhPhbm'E 8tdSPSƒtL0Hv6:-tB.&hSghSLVSE} ] E 8SPGƒtz0Hvd:-u_Bj/P肠ǃtG%t&'hhhV=߃PJOPVƃuUPhhPhthhP< hh`V袞8tX SW'tSPhPBPRj耞 ff%f=@tjtPQQSP-Ut&hhP; =&'QtPQQVS0[^_]ÍvUWVS}EE8Ij M QtGuM QC(P%uC(PM Q%CPWNH{ j<-t+j<-P~L‰UC(PRWhVH@vC(PWhV0@=SE P>E&'SE P>ƃ} uvEPEP\ǃN?EjjjjjWVÃu;tWVhh='WhhPPh눋C t(WVhh'Ph\t&C C8C<j<(t.C(Pj<(PhEP:%hhC(P}8E EPFEuhhEPEP4}thhMQ18Cl ShjAEPRC uot(tPHt&'PC(PhhPh\K 4IH4Iv'jjPޕSE PRj fC|EԉQC~hhEP'3hhEP3e[^_]ÍUWVS]u DžDžj/MQt@EM9.u_hj]t&;t!SXGGhM QX@uDžhM Q2@uDž\hM Q@uDž,hEM Q?uDžhM Q?uDžh8M Qr?uDžhM QB?uMQMQMQMQR hBM Q?uMQMQMQMQ&S MQMQM QhhI%Pha t&jjjjQMQMQ4Gt>thhV4Gh W W t[MQMQM QhhyPhMQhPM QhjMQjv8&'jjjjjMQMQyDžW t"MQM Qhh W jj jMQӑ†։W0jj jMQ译†fW4=w5MQMQM QhhPhO v}$thhM$Q73G j8R]S藓j@SoFjՑV迕jƑ u'VhEh v'SV{1W09t:9t6Rhhh(DžDžW09t 9uRhG tf4uMQhIΐt& =Dž<W(RjIFVVjjhl t&'RHF F fE%PEP辌PFPhj҆thfE%PEP莌PVuRFPuRj|Phj+:PqPhֻ(u~lthhFlP% F\PRD3'jFPSB tR SFPh%j躅t@SFPuRj{Ph j,GP~PhN m&hhFdP$0҉߈щ uщƄ FlP߈щHPSTF8hFPMh hSPF%$~ u-VPR$A:.uEVFPNuQFPBPBhFP6,t&VuIEPPSi8 8j h@Pj FPPLjj hWԇƒ$uSWPP誙RPaRPjRWɂ |j hWk t ucWS莂ڀtR,RP.aRP RWK!~HtWFPFPFP<SFPhj虂tojhBPSVuRFPjxPh j*PMPh買,S8PjFPj h08{jj老hPhP![^_]Í'U(WVSEEPEPMAP蔄ƃ }jjhlEPjEP( t 8t&EPOǃVh]S;jjjjjSWÃ(U؍C\PR?ssVBEC0fEfC4K C<C8MAPC(PCPhj tnMAPC(PCPhjԀtLMAPC(PAuPCPhejvPhj+UPPhe[^_]Í&UWVSuVdtu:tp0ЍX~>jjh Ph腵hhFdP $'SRP* jFPP; }F(PFPh(jtSF(PFPh0j~t8F(PFPhejuPh j,PJPh说N vhhFdP0҉߈щ uщƄ F8tSV0SF(PFPh:j~tSF(PFPhEa[^_]Ít&U, WVS}DžG ЋIƁ#DžPEPGP‰WG  jjPR}<8tMfffw|% %  щ#&'G|f|tjjh`&PhhZPh迲GPC?GGG}Sjjhl%Ph芲O S/~4IqH4IfPz>G G G$G\PR:jG(P‰Wt(tP| t&`PG(PhhgPẖGPS>GGPG>G S.t4ItH4IO t&'G jPR~t( fE%PEP訁PtPGPhj{S=Pjjes[^_]Ð&US]M UEjPjjRQS]]Ív'UMU EjPjjjRQ]UMU EjPjjjRQ]UMU EjPjjjRQ]U$NWVS}hNj VxE EjjjjjWhQÃ(tC u2WuRIPhhPhB5j0щHPVCPu0щC't(#!('.RPRIxltRQS Rh4V裾Rh0PQSR݅ٽ ٭߽٭VQhj"5eƒfjKatj:SFSRVhPkhPBRhRk0ҋt(hP2+BRhVPkhSg0J)ӉJRSPd 2}&0JRVVR1dF QSP5  v'؋ d=Gt;t;hhhh0h7h<hhjWc$ujjh=Ph袘[^_]Ðt&UE t*8t%=d.thd.hX.hjPjh{hd.Ebh{hX.6b]Ív'UWVS5G^ PEPCNjU9V t'ttVt4ItH4IF(u!PURFPhj*bt:F(PFPURjPXPh j,fPPh\ URFPF(PV2hxjjP)X/&ƅURhh'蓺Phe[^_]Í&'UWVS5G^ PWUt-tt#VEEt4ItH4IF(u!PWFPhj`t7F(PFPWj WPh j,|eP賹Ph WFPF(PVh7jjPV ue[^_]UWVSURE5G^ PlNjUURW  t)t}tV}t4ItH4IF(u!PWFPhj_t7F(PFPWjUPh j,TdP苸Ph WFPF(PoVɦhjjPU u e[^_]Ð&UWVSGs PJEPNjUURCP t*ttSkt4ItH4IC(u!PURCPhj^t:C(PCPURjTPh j,cPPPh赓 URCPC(P1S若hjjPT ]e[^_]Ív'UWVSUREGs PNjUURWY  U RCPA t,t}tS}t4ItH4IC(u!PWCPhj(]t7C(PCPWjQSPh j,aPPh] WCPC(PS6h| jjP-S ]e[^_]Ðt&UWVSu]UR;jjVjSU RV跠à C t'ttSt4ItH4IC(u!PURCPhj\t:C(PCPURj7RPh j,`P޴PhC URCPC(PSh_ jjPR<&'U RuPURhhNmPhҐe[^_]Ð&UWVS] SE P*SE PESE PEujjhr'?#u}utGP& uhWumhWruF4I&Gjj jP[ujjhXPt&}ujjh(1=ItIPWt F;uU:#u}uCS@uhSuWhSu5=uFh`nVq'e[^]Ð&UWVS1U RlU :Tu zt1=IU UIPUR]t F;ufEu agfEudRfEtTfEt?fEt*fEtfEu؃$hHURWS$$hRURW$M QhPRW V IRs|~tt&'q}WV(R~PVRRjxPtRhdWURVRSURV(REPM QjFPhyj-TP-Ph蒅4V V IRt4ItJ4IV9Vt RXVЃ‹!VRVRFFFN X,h&jjRE[^_]É'U`WVS5G1t(08F ȉMʃʃ=V8V<1QR,$f^]M1SQ,$fuM}tG fEu)t&fEu '}M Mm$ZmRh]S}TSh0Qm ؉G w 6؅tvjh0j)R tGPHI<fEu غXyDfEu غ[\t&LfEu غ^‰SPRj= K CPCC\PRMAP> W>jSShh輎Ph!k[^_]Ít&U,WVS]jjS; fEDžDžDžMyPtjjh;'VSMAP$> fEjjj6 jPjjQ8`jSQD8 FDžVSQ=jQS9EPEPEPEPEPEPhbMAP M QhMAPhjS9ލvjMAPS) u =T;5KhV7t1ۉWPC~t@PDžPEPQm6ǃ  QD'jjjjj F,Phkt@PhV[^_]ÉUWVS}1GtVvCtFPW u8C u0C F%IPt4ItH4Iue[^_]É'UVSEU t :1j jD'ujjh Ph#\E@Ph\Cj EPhЍ E uh h @t&E PR<+u1CVj hЍS Et2tNhhPhhEPAvu:j hЍS  (v'Shh ~Ph%[E PE PÃHe[^] UWVS}1Ѝth W(hD W(j j#'CPhP Wi(F j ShЍ à u׸Ѝt1h W;(tVhU jU$ t Vhb }[e[^_]ÐU$WVSDžE t 8ƅhh S0Ѝt =Jt5Jthh V hPV ;uЍPh g>U :E PRPtNJ <-u)Dž!'J!I\<+uG1҃=JtVJ1PW)uuJ 5It&B;u<JuWh /Y} 2[^_]ÐUHWVSEEEEEEEjN?tH={t?h XE PhM Xhh Xh X &'E =lJuh `Xt t&'h FX1ۃ9pJN lJt>rt!BPB PVSh  X&BPB PSh WC9pJ<-] SE PƃF0HEPh V uEE =<tE jwE܃Yh OWcv'MQh< Vq u:ESE P9E؃ hA WMQha V! uE"EMQhh V uE =<tg^&MQh V u*SÃSPtt&'MQh V u:E SE PIE܃hl V%MQh V1 u*StÃjE PS t&MQh V uE&'E 8%SÃVǃ~!Gj h IU]t&vMQV()Pf kG~Vh  Ut&E 8-0E 8%8E PoƃlJMQ}t)MЉK$t CPVh  CPVh T h\hK MQC P'h]hK MQC,P }t'MQCPVhR DT! CPVh~ !T }tYMQt8hkhK MQCP衾CPCPVh S 'MQh SjEMQduMQh Sv'EEEEEEEP% u EP uEP tVt(PsPh SEP7EP.EP%EPEP EP!ǃtt0+t&'hR&'%%PC%N%P jjjjjj jjj jjjjEPi jEP[jEPPEP%EP$EP$EEEW$G~hE}u1EhhK jE vEPEPKÃtB;t=9uuNMhhK WEP^EF EPP#4&hVƒu{jEPRMQQt(P1PMQh#j"vPh PWS t&4&hhK jHƋEPEPEP=lJu)h hK jŹlJpJ 1ۋpJ9}lJ<rC9|9pJu0K pJh!hK PhlJlJ4h(hK EP½Fh)hK MQ謽F~ EFEFEFMЉN$F }th2hK MQiF @F(FF0F4F8F<F,FD}th<hK MQF, F@FPFPWe[^_]Í'UWVS=lJh E195pJlJt}Ct*}tj(j+CPSqCt*}tj)j+CPS?}t}9{| PF95pJjqe[^_]Í&U WVS}jM PV à tt?v'M PM G@Gt VPhF VPhLMQPG$PjT] G$PWG~!++< t< u JKG tjjPPG,PG(P謑GtSPhFvSPhLMQt uShR0Lj[^_]É'UWVS}=vjEPW  ~9uzUu3%t&A0EÃY4%A8띐u%w'Bf=oЃTv'1ҋ pJ9L5lJMv t 9A tB9U%'e[^_]ÍU=pJthU:KjSjj E]ÐUWVS]Sƒut&'lJ4F$P}t E PF$P RhrYJ j} 0щȃ$)ĉE PS hwS0щHPSFPh{v$uV 1e[^_]Ít&UWVS}1ɡpJ9}5lJËt P(9|JP(A9|e[^_]ÍvUWVSE] lJj.jjjP"4t uj ڟe[^]ÐUVS]u jQ辟tkt4t<}&t8ufj>j.jjjPb3t uje[^]ÐUSU] MEu 1t&tMtuu@@XDt&@@&u@(X$X,'@(&u@0X4r @0^t&'u@8Xǃ]EtvxtpUE B49Wjjh0BPEhh$PhhEPlEE( E}uE9n'}Et`xtZtUjjh0EPEt6hh$PԠhhEPEN]uE9vEe[^_]Í&UjjT@Ph0]ÐUSJj-hj=JuJ&[{uC]]Í'USJE9uBJ)t&ztB9tƒzuBt@BEPjHh]S]]Ív'UVSEEjQhP]S]hSjShSs$u t&0@Vde[^]ÍvUS]ES艱EujfhSEPޟhEPjhhEPu!'[@S]]Ðt&US]ESEuj{hSEPNhEP5j}hEP[u!'@SD]]Ðt&UVSuJt%P9u '[u1e[^]Í&'USE] PtShP3']]Ít&UWSE] P_t(P0HPjS'e[_]ÉU(SEP uhhh{Mt&Ph'S tjS-&ƅhhP]É'UWVSE} P~ƃu%hhh{衠D hhGPËPWjSt t&؍e[^_]ÐUEPt P]Ð]Í&UEPt P1]Ð]Í&UWVS}|} }t&uw@W2ƃtQWVURà t-uVjrv'SVU R 9tV vj91e[^_]Ít&UEPu1]Ív']ÐUE@JD ]Í&UUE t38t.hh PRJPs] hh RJPv]ÉUWVS]E Eh h PEPEP0}ЍpE;VPEP tpE;u;to0H9t);t!VPEP? u U;uh"h EP蠙E-uFE EPVhJà }} [Ju}} [ Jt-E u{PVh jeǃ}} [$JEt t$t&Vh -nvE PS_t&Vh u-؃]9}Bvh{PEE@9|$'1ۉh{SC~e[^_]Ít&'Uh !jh2!jh2!jh2!j hJ!jhf!jh!jh!j h!jh!j h!j h!j h!j xh!j lh!j`h"jT h"jEh1"j9hc"j-h"j! h"jh"jh #jh%#j hB#jh^#jh#jh#j h#jh#jh$jh;$j h;$j!yh$j"mh#j#ahz$j$U h$j&Fh$j':hz$j(.h-%j%" hS%j*hm%j+h%j,h%j- h1&j.hx&j/h&j0h&j1 h&j2h&j3h.'j4hQ'j5 hQ'j6zhU'jV h'j?Gh'j@;h%(jA/hT(jB# h~(jCh(jDh(jEh(jI h(jJh)jFh')hh)jG hT)jHhm)joh)j7h)j8 h)j9xh)j:lh)j;`h*jKT h*jLEhB*jN9hf*jQ-h*jO! h*jRh*jTh*jUh*j[ h*jVh&+jShL+jXhu+jY h+jZh+jWh+j\h+j] h+j^yh/,j`mhN,jaahm,jbU h,jfFh,jg:h,jh.h,jy" h,j{h-jzh/-j~hL-j| hP-j}hj-jkh-jlh-jn h-jmh-jqh .jrh.js h5.jtzhM.junhe.jvbh}.jwV h.jxGh.j;h.h,h.h h;/h hU/hho/hh/h h/hh/hh/hh/h h/hh/h~h/hoh/h` h/hNh0h?h:0h0ha0h! h0hh0hh0hh1h h&1hh[1hh1hh1h h1hh'2hhT2hsh2hd h2hRh2hCh2h4h3h% h,3jhK3hhc3hh}3h h3hh3hh3hh4h h-4hh4hhN4hzhk4hk h4hYh4hJh4h;h5h, h5hhG5h hn5hh5h h5hh6hhT6hh6h h7hh 7hh 7h~h47ho hG7h]hu7hNh7h?h7h0 h7hh7hh18hhr8h h8hh8hh8hh8h h9hh9hh9hh7hs h9hah9hRh9hCh:h4 h#:h"hL-hhQ'hh?:je hI:jdhI:jchR:hhR:h hR:hhR:hhZ:jih}:jj h:jpw]ÍvUWVSDžhT|j7~Ph:S1Sch:Pu5Sh:!hh PĊv'1J1vJtPPh;R Ph;R G~R`PRh; !hh P1[^_]Ít&'UWVS1J1ېJthh V׉ G~Սe[^_]Ít&'UVS]1S]EPEPShjhJsVt}|1 E@JTtitCmtubhh D PBJhh DP茨P#+hh DP vDP膮Ɖe[^]ÐUWSU0Ѓ$)ĉRSMSOEPEPShjh`eU}|1t&'e[_]ÉUPWVS=`tL`u1ۋ`PhAVJjjE uDPV PURo |ue[^_]Ð&UWVS`1v`t]hPhhAj GA`Aggfggvoe[^_]Ív'UWVS1g1҉gt2D1PD1PCPWhAUMUMuЃG~e[^_]Ív'UWVS1=ouhMQggtLCPMQ藔u0t fFC.C..&u1e[^_]Í&'U WVS] EE0}HEhhAjEP!E=`1}MQ`PMQ3 utUhhA`P RVJ B9u:rhhAPEP臅E ;uE`L=pMQGPMQ u`UhhAGP R襅J B9u$rhhAPEPքE?uEe[^_]Í'UU_=_t$8u@Љ] 8uhhAh{T]UWVSuM UE1jPRQ:EjCwt&0UЃ$)ĉRWV蒉pt%CPVtut EPC )EPVaÃut&'U0H9vhhAEu{Pe[^_]Í&'US]S裟thhAh{.t&'@PSQ^hhAu{PH]]ÐUWSEP?thhAh{t&EPEPƃjj jRÃEPƒthhAh{qv'}hhAh{Rt&'U0щH9v0щH)‰UhhAUu{RT~e[_]Ít&'UWVSEP>th hAh{!vEPEPŃjj jRƃEPƒth hAh{&EPEPsƒjj jRZÃEP褝ƒth hAh{&U0щH9sHU}hhAh{L&'0щH9s t&E{hhAUu{R|e[^_]ÍvUUEPR͖E]ÍUS%Ћ]]Í'USEP蓜thdhAh{Wt&'MQEPjj jPÅuhghAje1RxP|]]Ð&Uj>P0hshAh{{]Ð&Uh~hAjPP{]ÍUSEP裛thhAh{at&'UREP#jj jP ÃhhAStSr'{P{]]Í&'UdWVSEPthhAh{EvEPUR胂Ãjj jSjƃ<U)ӉؙƙU)Ӊؙǹ։)ؙE]t-P胕WMQh%BSY0э\ t*VRPVh0BS-0Ѝ\}t0EPWURhtAC$ACF>uЍe[^_]É'UWVSu1hhA0H@Pm>t"vVt¿Ј C>u ȍe[^_]Ðt&UEhhAPP聍Pr]Ít&USEPuLUREPxS u0hhASEPmP#P'hhAh{q]]Ðt&UVSEP蒑thhAh{-&UREPyjj jPƅ}QhhAh{&EP'|UREPwS |NŋEPthhAh{UREPwS軐 tThhAh{YvhhAh{E hhAh{% hhA؅u{P5pe[^]ÍUE8tPOv't'hhA@PDPo]Í&hhAjPo]ÉUE8tP߾v'u'hhAh{so] hhAu{PEo]ÐUE8tPov'tP]Í'hhAh{n]Ð&USEPt h zt&UREPuS軎 th R'EP藎u0UREP3vjj jP%PSu$vh hAh{M9tVp(DP tpU2tСp(DP tWt&9tN]9X0Ѓ$)ĉUD2PS SVt&SFP&fƃYhLhAEu{P-ce[^_]ÍvU VSEEPth\{v'UREPjjj jP茿ÃhahAEPbEEP跂uUREPciV蛂 t$hdhAh{pbt&'CPjEPEhSEPEhghAEP)bE$Et8th{P,EhjhAV]SR_EPh{SsbhlhAEP](hmhAEP]Ee[^]Í&'U VSEEP蘁th\v'UREP#ijj jP ÃEPVuUREPhV: t#hhAh{av'},hhAEu{P`t&'CPjEPEhCPEPEhhAEP`E$Et8th{P~EhhAV]S]EPh{S`hhAEP\(hhAEP\Ee[^]Ít&'UWVSuEEEj/V?Ãuht&CEPV"}EEPS}19u~T19}GEt6PEPiiu"EPh{EP_E C9|F9uhhAEP"[hhAEP[EuhhAh{_e[^_]Í&UWVSuEEEj/V/Ãuht&CEPV|EEPS|E19u~a119]~6vEt#PEPUhuEC9]ͅuEPh{EP^ F9u19]~#uEtPh{VV^ C9]hhAEPYhhAEPYEuhhAh{]e[^_] UVSEUREPddƃt;vUREPKdÃt"SV DtSh{EP] ȋEuhhAh{5]e[^]ÍUVShhAh{]EUREPcƃtKvUREPcÃt"SVkCuSh{EP\ ȋEt&'hhAh{\e[^]ÍvUVSh(hAh{d\EUREP$cƃtKvUREP cÃt"VSBtSh{EPU\ ȋEt&'h5hAh{[e[^]ÍvUVShAhAh{[EUREPbƃtKvUREPkbÃt"VS+BuSh{EP[ ȋEt&'hNhAh{L[e[^]ÍvUWVSEEEEP){thb}&MQEPaWz thbOv'EPzthc+MQEPsaVz thcv'EPzthdMQEP#aS[z thdv'VES‰UEEUEPEP`ƃt:EPEP`Ãt$VW}@tSh{EPZ 벉hthAEPUhuhAEPzUEuhxhAh{|Ye[^_]ÉUWVS]0Ѓ$)ĉSVܴSEPzhhAEPU~GPjV]E&hhAh{Xe[^_]ÉUWVS]0Ѓ$)ĉSVLSEPzhhAEPpT~WjVEt&'hhAh{\Xe[^_]ÉUWS]0Ѓ$)ĉSW轳SEPyhhAEPS~hCPW;EhhAh{We[_]ÍvUWS]0Ѓ$)ĉSW-SEPxhhAEPQS~hSWE'hhAh{PSvi u?SEEPh{EPIEPS5Et&h$ hAh{ Ie[^]ÍvUWVSE=EPht h5 UREPOVh th5 z'Et98t4j Pħh: hAu Eu{PjHt&VEt8u;h@ hAEPDhA hAh{$H j P@ÃtOCEPVw=hS hASGhT hAEPC&&h{V+=Ee[^_]Ð&U$WVS]EEEEUEXEEEE t }}t#EPUR謱U܉h hAEP=Ee[^_]UWVSEt8uh$ :&MQPHjj jPoƃEPat"h' hAh{A'U0H)y&h+ hAЅu{PKAA'؉h. hAFP<Sj Wޢ;EPW蠠e[^_]Í&'USUREPEËEvSPPt @h? hAEu{P@]]Í'USUREPEtjj jPCؐ&hL hAP7@]Í'UVS]Etu$hT hAh{?[&'hV hAP-[P?E C;t"uP [Ph{Vo@C;uEe[^]Ív'UEP_thd hAh{V?]ÉUREPFEPJ_ uɋEt8u hm.PEPQEthi hAP>]Éhm hAEP:hn hAh{>]Ðt&UE<v<w(hw hAjYP>]Ív'hy hAjYPf>]ÉUM< v-u+A]Éh hAjoYP>]ÉU1M9tIv< v#t-uA}t(9UET0 v'&CPSYKB9|CuEe[^_]Ít&'UEt&8t!URPG;jj jPВv9}#hW hAh[B5]Ít&'Pmu"h[ hAhcB5]Ív'uh\ hAhgB5]Ívuh] hAhlBw5]Ívuh^ hAhqBW5]Ívuh_ hAhwB75]Ívthb hAhB5]Ívh` hAh{B4]Ð&US1ۃ=otGhj hAjJE8t7URP;PBEP7)hr hAEPz0}uht hASOPx4]]ÐUVS=oth~ hAjOPt&EPGTth UREP:VT th v'EPS|UREP:SS u`VAESAEPEP̒h hAEPo/h hAEP\/(h hASNPvh hAh{L3e[^]ÍvUS1ۃ=otGh hAjJE8t7URP9PHAEPא)h hAEP.}uh hAS1NP2]]ÐU WSEPRth $t&'UREPC:jj jP,ËEPvRth t&UREP:jjP> ݝPhBSSWjjW ٝم$hBWє0Ѓuh 3v'H(0t(.uHƄ(Nh hAh{st&'ShBSVSP= u SW譌 th hAP0[_]Í&UdWVSEPPth hAh{HvEPURc8jj jQJ<U)щș)ș)ىșE}}t-PhBWI0ɉ}щMUT U t0ShB}W0ɉ}щMUT U t0VhB}W0ɉ}щMUT U }u}u,u(u$}WhBEP蚒 'UBh hAEPf/e[^_]ÍUUEPR=IEPEPhB1]Í&US]ـ;t$<wt t$ @A9uh hA؅u{P.]]ÍUS]SNth hAh{At&'h hASРtSà&'{PU.]]Í&'UWVS1MM]9vxCtGp(DBt CDBut&<,u"Ctp(DBt CDBu0PSV襊 1;u t&C;fhD hAMQp-e[^_]ÍUSEPcMthM hAh{~&]SEP4jj jP̉ƒ|9hQ hAh{8 BBTuh[ hAЅu{P,]]Í&'Uh` hAPGP,]Ít&'UWVSEEt8t}WP3ƃu hw }WEP2t:< v-t+uA< w QgMÃjQDÃvEPlt@EtVP5uՃ~E9Xuh hAE@Pt&h hAjFPv+e[^_]ÍUE8tPzv'u'h hAh{#+] h hAu{P*]Í'US1ۋEt'8t"URP1tjj jPiS&zuh hAjh hA@PEPt*]]Í'UEh hAP.PEP8*]Ít&UWh hA0}HPjEP*}]Ív'UVSƅUREP0ƃ ouo1&')ȉȿ<)ىșƙ)Ή)։SQWPhBShhAS#[^_]Ív'UVSu1VCt#hhAh{ hVP. u+3O$ R `S hS 0S hS R hS hS hS S hS hS PS hS hS  S hS hS hS @S S hS hS hS hS hS hS hS hS hS hS hS hS `S hS 0S hS R hS hS hS S hS hS PS hS hS  S hS hS hS @S S Ƅ+3nƄ+1^Ƅ++NƄ+0>Ƅ+(.Ƅ+5Ƅ+|Ƅ+4C+hhAP![^]Í&UVSu1VAthhAh{uhVP, tD+)+C+t *+C+uhhAP![^]ÍUVSu1V@t#hhAh{ hVP., + *$T 'PU `U `U `U PU `U `U `U PU `U `U `U `U `U PU `U `U `U `U `U PU + *+)+C+=hhAP[^]Í&UWVS}W?thhAh{hWS* ?dc…}B$)Otzt4( 'u -&u  *)t&Fu%t&u  *u)F~&Fu%t&u  *u)F>&Fu%t&u  *u)FFG?h2hAP[^_]Ít&'US]S=t h8*t&Sʸth:hAPh<hAh{l]]Ðt&UWVSEEPW=thEUREP#W+= thEv'EP=thFUREP#V< t$hFv'E;&@tVWCP*tVC Pu‹u؅t(}t"CPCPC PCPhBhShAh{,e[^_]ÉUWVS1EEP<th\t&UREP"V; t$h\^'hbhAPNvjEPj$CPVv%uC uWEPS à uhehAh{`e[^_]ÍUWVSE1EPE;thohAh{v'UREP!W ; thohAh{jEPjdWCP$uFEt(8t#huhAPC PO v'hwhAC P] FjEPSà uuh}hAjh|hAj5P6e[^_]ÍUVSEP":t hMQEP V9 thv'EP9th~'MQEPs S9 thR'jSVhYBƒt)Bu{PBPBPBPhBt&hhAh{,e[^]ÍvUWVSEhPS$ك tQv<wA &<wؿaA9uhhAP[^_]Í'UEPt8thhAh{I]Ðt&UREPjj jPtH$@] ^ ] `] ] ] ] &hhAhB]Ð&hhAhB]Ð&hhAhC]Ð&hhAh C|]Ð&hhAh0C\]Ð&hhAhIC<]Ð&UWVSEP17t h-vUREPjj jPsÅhhAh{dt&hhA0}H@P*ƃ EPV2vK0H=vƆe[^_]Í&US=ot#hhAj1P'EP76th~'UREPjj jPrÃEP5u?UREPjj jP{rhhAPSuP1PhhAh{]]Ðt&UhhAj0Pc] UEtf8taPK5t$hhAh{ ]ÍUREPjj jPqPkd t'hhAP!0P]Ít&hhAh{]Ð&USEtU8tPP4thhAh{hUREPjj jPp'hhASzGtSmG &{P]]Í&'UVSEEP3th&MQEPcjj jPLpƒ ~1ҍRHDP3u9DPD PDPDPDPhXCEPbE!'hhAh{e[^]ÍvUVSEEP3th&MQEPjj jP|oƒ ~1ҍRDP2u9DPD PDPDPDPhXCEPE!'h hAh{Le[^]ÍvUVS1EP@2t heUREPS2 th@'Et8tURPƃ%PjS"hhAh{e[^]Ðt&UVS1ۋEP1th"hAh{t&UREP#jj jP nƋEt8tURP Ãt hgCSujj &jjV uh,hAhqC&'h,hA@Pe[^]Ít&UUE PP]Ð&UVSE]SP-hd jVEPPmVS1.e[^]Ð&UWVS=}E8URPjhrCS`u ÉjhuCSC u 1멐&jhyCS# uEP/thRhAh{=UREPcjj jPLl;v'VWee[^_] UWVSEM UE:]5p(u}])8upGEUBUNJtsUtًuD^u DFtNjU:tKE8tCEjj PRqkÃUEjj PR[k9t )É"E8HEE)‰Ѝe[^_]Ív'UVSE]SP+he jVEPkVS+e[^]Ð&U0WVSEj,j]So }ލ}АE8P-UREPS- SuVjjP>|r19]~vEPh{W  C9]VWJ}jEPa-uJEYt&h>'h.'hhAPp(Pv'hhAh{ e[^_]ÉUS1ۃ}tEE8tSl#vhhAh{| v'}%PW~e[^_]ÍvUWVSEPQ*t hMQEPW+* thv'EP*thMQEPS) thv'EYBt8tjVShYBƒt&BPBPBPhC b&'SW Ãt0VC PtC PCPCPhC &hhAh{ e[^_]ÉUEP)u=MQEPjj jPeƒEPRhC= ]É'h hAh{]Ð&UVSEP(thhAh{&UREP#V[( thhAh{EP7(t hhAh{UREPS' thhAh{XvjSh@Q t,@ PVthhAj'hhAj"Pve[^]Í'USEPc'thhAh{pt&'UREP S+' thhAh{8vSuh"hAjt&h!hAj/"P]] UVSEP&th*hAh{&UREPC V{& th*hAh{EPW&t h+hAh{UREP S& th+hAh{XvjPV t+PSĜth/hAj h1hAj Pe[^]Í'UVSEP%th:hAh{&UREP VK% th:hAh{EP'%t h;hAh{UREP S$ th;hAh{XvjPVr t+jPS2E t@ t@th@hAj hBhAjPfe[^]Í'UVSEPR$thKhAh{&UREP V$ thKhAh{EP#t hLhAh{UREP S# thLhAh{XvjPVB t+jPSD txthPhAj&hRhAjP6e[^]Í'UhWhAj jztj j z t&{P]ÐUWVSEP"thfhAh{(vUREPs W" thfhAh{EP"t hghAh{UREP jj jP^EfEfEjjjEPWƃ|mVhnhAjvVhBiChphAWCUS s$ShlKhuhAV hjhAjPe[^_]ÍUSEPp!thhAh{t&UREPjj jP]ÃtcStPhlKE tHhhAPhhAEPhhAEP$ShhASP]]Í&UWVSEP thhAh{EPEPƒjj jR\ƒ׃jWPhlPuUREP.Sf uWS(tF}uhhAj P e[^_]ÍUVSE1҅v8m1Zu-_w_Et&_tu_v'<v _$ v'   p    t&ƒPt8)(2[u{_y _^t&_Nt&p(DPt8,<>w"__FAK9hhAR Poe[^]ÍUSEEPYthQt&'UREPS+ th#'EPS~QuhhAh{'EPhC;]]Ít&UVSuVuHVOP$S $C}U Um$XmPPV}vhhAh{<e[^]ÍvUUtA:tu)hhAjX P]Ít&'hhAP* P]Í'UVSEUREPÃu jDÃSth&j@PS EP9EÃu{ thhAhYBVi{tCPh#B.t&{tCPhC CPh~CV hhAhCV xEP8Euh hAh{ue[^]ÍUVSUREPV tOVP<Ãt:hhASJEtS=E &{Pt&V*=ÃtAhhASEtSD {Pg&V*CÃtAhhASBtSB {P&h hAh{<e[^]ÍvUHVSƅMQEPƃw/_#E<t <t <t<tF9u|=EU9uE) |PhCS>0Ѝ\CF9thhAxPh[^_]Ív'US]EvEPuhhAj:&'EtSPluhhAE@PPf]] UEEEP#t,E@PPh{EPQЍE]É'USDžDžDžDžEPthhAh{bv'UREPCjj jP,:ÃPPPPEPt#hhAh{ $@ p   И   P    &PPPhC;PPPhCPPhC+&PPhC &PhDhP8t&'PPPPh D.'PPPPhDhPV8}PPPh#Dt&PPPh.DhP7'PPh:DhP7hhAP3]ÐUEj%hDDPho]Ít&UEU M.. .] USEU CJ9~&9PPY; ]]Ít&UVS]u PP;t&HB9~"'9 1 &e[^]ÉUWVSo. t hК th joPR6ƅ9ooBPPhLDQ*t<*<@~otVP蘽c.o9o|qhhDDP<áo2PjSn8otoPRS3 o2hhDDhoKo hhDDjooMHhhDDD>*tPPo~&SWVMQhD\P2tXSWVhDj:2tBt>t:SWD>*tPj(PhDjD6PŊPhTD*ge[^_]UWVS1E8ƅURPuÃu,jM-6tjjjM6PRPV0<@t <+t<~t<-uF<+uCSj+hDj[vCSPhDjW5PPVf4)'ShDjT5PډPV;4hDV-4GuVhTD!fƅ1UREPÃPhTDe[^_]Í'UWVS] 1jSp Ms[]PVjV/E8t8 uG@8uMQVMQMQhD\P/tbMQVhWDjD/tJht9WVj%PhDjL^4P蕈PhTDdMQ jPVjB'j%9otNj%ot%PPhDh.5 D.D.fDf.Etj P7t@Cu.t9.t9.t M9=tM<*w<@o}e]otVPݸBMQVMQMQhD\PE.MQVhWDjD).jV-jL2 tHSVj?$PhDjL2PPhTDKcMQ" v'M<=t'<*ta<@t\qv'ot#0H9vD>o0MQVhD!&MQVhDt&MQVhDh.bjj,e[^_]ÍUWVS}E pjP/mPS@uPt7jVPSWjjP# jPSht&jS+VSWhD\Pu,tAVS8D:tPWj"PhDjG1P8PhTDae[^_]ÍvUWVSu>-u1'+u ft&<v<wRҡ *PP3+ WPP:otOuWPa F>le[^_]Ív'U塨Pt8tPPj PhD]ÐUWVS} EuMuFuF^ FF]tI9sMvAtB\uAu\I@f9vҍAtf9wf|VP VP[^_]ÍUWVS}u f;{uf{}uf{u VS48j{SX ÃuVWEPVWSu͋Ee[^_]U WVSM] 9tff9uDžqf>tgff[u/t&'f>tf>]uf>u0,&f{u f}utf>uuf>u#}WP#})'Dž9fƒ[t!,tzt&{t;}tFf;tf;]uf;t&t&{ tf,t]9svff9rfFfN&fffu}WP}K9}1[^_]ÐUWVSuEf>~u{@ tu^U f~tvff/t Bf;u} ?u8hD'ƒuHh(%P-t/ } W-u? PM :tf:f9B:ufffuE e[^_]ÍUWVSM QSURNjރ ,?*&[!uf?t$j]WRu"f[!'f[!uf!ff?-u _]tf-f]uÁI f]>t&I f?+I 9tf~*tf* ffQPuk9u'A u %=uQURzB&A u2Yt+hЬ j+PI؋Pp%1[^_]É'UUE PP*]Ð&UEU f8tRPPP]Ð&1]Ív'UHWVSu ]E}}f;f}W}W}W t 1}G tIf~/tBfEf%f=@t)f=u.W}W}W ufEf%f=@u f/fF}GW}W|ff/tf}Eff:u܃}u2Ήff/fff/t'}WRSV}We[^_]ÍUWVS}M ft(WMQuHt2SMQbt(PSGЅuG t 1'1DžXG @t OQщƒB <.u Mf9.uԋ] %f &ffBfuMQMQM QO uM f늍&'WMQSMQƃ]G @tQG'Q)[^_]Ðt&UWVS} GӋGtRP&S"Åt}uG~HxHy_UMf9t ffu+EPK"ƃtVMQG4G1ue[^_]Ðt&UWVSu] 9]Hf=?tx=*t v'=[tyt&9]tv}WSV tffu1&'ff` Efftf;!%t94&f;-uf9w f9KrEf9uEff]u9ET'ff9<f>%e[^_]Ív'UWVS}WtAO4! t P'KuGP'e[^_]Ðt&USU] f:ufDft&'PRCC @uP$PC Ћ]Ív'UWVSEu }SPG @uVSj$ v'VSG$Ѝ[^_]ÍUWVSEu }SP~G @uVSjv'VSG(Ѝ[^_]ÍUSU] f 9tfu1&'Ћ]]Í&UMU vBu]ÐUVSu ]1ɀ;t@<wL ʁt1!C;u‰1Ѝe[^]Í'UWVS] EPURzjbhDjNjjdhDURcGvu8VBP&'1@9s<tÍe[^]É'UEthxjt vhhDV\ ue[^]Ív'UWVSu]EPV7hhDj8贯‹jVBPU访UfDfDЍe[^_]ÉUWVS] E1PMQ4ËtTCPMQ诽u8}tt(fNt ߋu1e[^_]ÐUWS]E0҉߈щM| *u$jCh|FSEPI&'jFh|F߈щ@P肮‰USRhFEPjcN=ot ou@o<'jXh|FEP耮oo@'Bo=otOvoXtPj,襡PtCuSEPؘuo@ouoj_h|FEP1e[_]Ít&'US]\PU RPh]]Ív'UVSu] jcjc  o9xotnujyh|FSBPvUB o@jh|FBPhh|FEP =ouo vohh|Fjy‰UB2oBB hh|FSBPxotEB Eo=ouooe[^] UWVS}o9}x)19}@oEP ohh|FPhh|FEP C9|ouo@=oe[^_]É'UVSutJ>tEv>t=hFV謿ÃtCVoPooރue[^]ÐUjct =ou1]Ã}uJot@ u&kYPUooo@] ot@u &'YPooo@] UEP$t PXjP]ÍUEP]UWVSjctlhFb@E PE Pu tPjc话9~ jc衝ǃo1t 9}CPPhF? [ Fue[^_]ÍUVS]u Et;uo{th4h|FSho[S蒾u;S%tt >tVGh=h|Fat&hFf?[t&SotT9uHt$>tVBPhF谯E"t&'hMh|FBPEP蹩Et&RuPhF>1e[^]ÐUWVSu]EPVhhLj 4‹hhLVU蚬UBM JfDfDЍe[^_]Ðt&UWVS] E1PMQH4ËtTCPMQu8}tt(fNt ߋu1e[^_]ÍUWVS1EUPztHU^t3UTzPVzPWQFPhLM*=GMu͋6uEA~e[^_]ÍvU WVSEDž1h hLPPާƅPPƃt1thhLW蛶 hVW茶C 9] u9] ~/u NhL9}LPPX C9] ׋t08t+hhLS*hPSh5hLPP[^_]Ðt&USEU M] $ (,]]ÉUS]U (C9t9~81&'RCP薳u$K 9t9~t&1]]Í&U WVSE}PhL]Sj jjhPzSƃjM QE HPtPh` M QFPTEt^@hrhLPФhshLEP躤hthLEP觤$jhPzjSƃhyhLj$‰UMJ zM JMJBM$J hhLM Q`‹EPhhLMQE‹EP$@Pѩh` EPFPe[^_]Ðt&UWVS]}u }*M$QVWMQMQMQM QPZt&jVFPtPh` M QpSEtF@hhLPWhhLEPAhhLEP.$hhLj$躢Ej$jPEMH xpMHPM$H hhLM QP袣(hhLMQEP腣E@Pih` EPSe[^_]UWVS]} j6ƹ{CtCtj{tLRPCPC oPL{uPS "t'PCP"t'PWhLVH[v{tLRPCPC oPL{uPS "t'PCP"t'PWhM7v't\CPC oPL{uPS "t'PCP"t'PWh4MV~ZPhM6NCPC oPL{uPS "t'PCP"t'PWhIM6e[^_]É'U WVSE1tNPhL]SjjhPzS@ƃtn^tgFPSGuQv'11ҋPzt0^t!FPSUMGUMu6u҃A~e[^_]Í'UWVSE1ptǍvpPSCFue[^_]Í'UDpWVS] Dž؏DžȏD{ƅtEPShPP>= t1҅tREP4u}}KEPhLSLjjhPzSƒtcB܏Q&'E p| tD u'Epp܏uF }|E pDžďDž11DžS9ďt,ď1Džtȏ@ȏ1St#t%9t1t&{ t*jPh{CPT&CPPTƒ9}ރ{ thhLPc tȏ@ȏDžЏ DžЏ{gE{{ ~}u3#v}u(tEPVhM7/t&EPhM"/e[^_]Ð&UVS5jSjjSC~1ېjjjjS*C~5e[^] UWVSu U}}}MQWRVEPjWGPtЀP,h` VMpPm‰U}u6pPB "t'RV"t'RhM-E@h'hLP褗h(hLEP莗h)hLEP{}pPVhMt- 11MpEtvEt9xt uZVtEE@hDhLPhEhLEPҖhFhLEP迖$U]uMp}u.tWpPhM,t&pPhM,e[^_]Ðt&UVSu] M1E"{{ tE'C t- tJt&t+t69t&M.'M'{'MCtPQRhMVNQRhMV;CPURCPRhNVe[^]Í&'UWVS11vpt.{t} tpPSMQU UuԃG~11ҋPzt-^t&v{uFPSMQU Uu݃G~e[^_]Í&'UWVSE}t0}HEu#hN'uvEP711pvEPPEPU Uu);0щHEE9EtBu &u|F~ulEPƒtJEP聹EEH=v h.N)R ];t&'EPhSNt&~EPhkN) Ee[^_]ÍvUE PE P蠜Pƒ tE PhMR]Ív'U(WVSu VE PZÃ;#u8VE P>ƒuhN8t&'RjECE&t@t+t&''EC E-t"+t;I'^t9'C-&1C t&'C &SUƃuh0HEE11EPpPS_ƒ uVE }F~t&4u+jm4thN'hN'1EM -t ^t!'EAM EPE PE P‰U }jpPREE}'uEt50ҋ]߈uhOt&jEPEPSP}tE {E8E E E@E E؊P<v<v tۀ t֋U :{u.j{E PÃuh&O`&hoӋEPEPEPEPWSEPV" };EPt) &K<v<v t te[^_]Ít&UUjE PR]É'UUjE PR]É'U WVS}EM9U%EuO} uhOMQ} u vE 'E HM P<v<v t߀ tj(VBƒuh P/'dv'EPWRUCEjC tEPMQh!P"$ EP6jyh@PEPDE 8{uj{VE 9]E jhEPPX uE &jhLPE P0 uE E &'E HM P<v<v t߀ tڋE 8{uj{V t&E &1t$jjWPj |t&'} :e[^_]ÍUWVSuEEE 8{j{] SEuhRPk%E U8LSP:hcPP蟘$j(Sǃu#hiP %=t&   jju{PURjz= u= t Đ&hh@PWEP̊EPu{PEP@Et<0t '1hh@PEP諉 Lhh@PEP草  H jju{PURjzjju{PE Pjye[^_]Í'UWVSEuzP%Ej(] Sx‰UuhPb#C'0щȃ$)ĉRVXj{S‰UuE EU0щȃ$)ĉRS  0Ѓ$)ĉVWEPUu{RW>EP9Euchh@PEPjjUu{RSjx = t qt&= _   h h@PEP芇e[^_]US] 1ɋU:tB8uAt&ȋ]]Í&UWVSE} t)E <v<v t u E @E u؋E 8-u@E 1] SE PƒuhPn!'EPMQR2P|ESE PEu%h:h@PEP蒆hP!TvE 'E HM P<v<v t߀ tj{E Pƃu&hCh@PEP#hP t&WEPEPrE uhJ&'0}HE M19}~f1ېEM @PMQM jjEu{PVj6vhWh@PEPa(G9}hZh@PEPBh[h@PEP/e[^_]Ðt&U(WVS]DžDžhPS%DŽOyj(E POƃuSShQ:t&Uu{jPRVt;t8u"hh@P'E j{P‰U u#ShQhh@P}v9u&Sh.Qhh@PPBDžPPAt2uShTQhh@Pv'1tHj{E Pu ShkQhh@P tP蟋2v'ƅ0H1919tC9~+PPXF'Dž{-t&9~t&QPSCF9f jjEu{PQjr9 hh@PP萁[^_]ÍvUWVSEEEj(E P‰UuhyQ[0Ѓ$)ĉRSj,SEuhQ MAM<v<v t߀ tj,Q*EuhQ.'MAM<v<v t߀ tڋE EEEHMP<v<vހ tـ tj{EP‰Uu-hQ-&' 0Ѓ$)ĉeRMQuu{jjVSjpp  0}Ѓ$)ĉMQS5EPVSB6Etf<0tbh'h@PEPOjjVMQjo = /= t  jjVMQjoc&  h6h@PEP~e[^_]Í&UWVS}uj(] SF‰UuzhQ0t&'hIRhxhuRl&'jjVPjoIt&'jEPVR5EjCqtEPWh!P j{SEhRp&E1<(j(EP=‰U jEPVR4EjCqtEPWh!P0 EPEP hthh@PEPA}E 8;u@EE8(nj{EPE8;u@E}"hh@PEP|e[^_]Ðt&UWVSM p(DC tʍBE BDC uU :(uwuuuE{j(E P 0Ѓ$)ĉRSEPuVS3EPϡhh@PEP*|$Bt&E PRjEPuVR2EP苡hh@PEP{(~+#'jjuVE Pj}lKue[^_]ÐUWVS]MMj1hRM QEEj,SƃtSdAjjWhX{EOShX{EjjOhRj0yEjPhRS@~‹EPPE(P 벍EPhX{rEMHt,FjYhREPy =X{EtEPEBuM 9te[^_]Ít&'UWVS]} } ׍j,St;SS1tjwhRS-} &S*jjQhX{m}uShRShX{uhhRPxhhR(Phx@,t@hhRP5xhhRQxu‹@(tAvhhRPwhhRQwuhhRPw hhRj04wHPhX{X{t PBu\{}t}}}t}t4 !x!x!x !xRv'M H !x!x!xRdv'M H!x!x !xRDv'M H!x!x!x R$v'M H!x!x !xR} }tS}tk}t}tt @Po@PhS J&@Ph*S *&@PhHS  &@PhhS &} PV7E thSV#E thSVE thSVE thSVE thSVE thSVE @thSVE thSVEthSVE thSVoE thSV[E thSVGE thSV3E thSVE thSV E @thSVE thSVEthTVEth TVEthTV@PVhT  t,Ae[^_]U WVS]E1SthhRSw 'SEjjEPhX{E@Ph$TF h#hREPsE@,Et6uEh'hRPrh(hRVr]u΋E@(Et7uEh-hRPrh.hRVr]uh0hREPsrG v'ujjEPhX{E@Ph$TNh:hREPrE@,Et2Eh>hRPqh?hRVq]u΋E@(Et3EhDhRPqhEhRVq]uhGhREPqG v'uEPhCT~hOhREPHqe[^_]ÍUSE] =X{tMjjPhX{Nt:X t0&'Xt t&Xt t&1]]Í&UE=X{t!jjPhX{t]Ðt&1]Ív'UWVSDž=X{ hdTs}t0}H5X{}tRFPURz ƅF=ujhtT?'^ujT{PhyTvvN u%jhThWSt&'t hhS?t+jT{PhTPh}ThW  &thhTW  FthhSFFt*jT{PhTPh}ThW謕 &F thhTW~ FthhSEt&Ft*jT{PhTPh}ThWL &F thhTWJ~ FthhSEt&Ft*jT{PhTPh}ThW &F thhTW} FthhSEt&Ft*jT{PhTPh}ThW茔 &F thhTW} F thhSEt&F t*jT{PhTPh}ThW, &F thhTW*} F@thhSEt&F@t*jT{PhTPh}ThW̓ &F @thhUW| ~}hhSEt&~}*jT{PhUPh}ThWl &~ }hhUWj| F thhSEt&Ft*jT{Ph#UPh}ThW  &F thh(UW | F thhSEt&Ft*jT{Ph3UPh}ThW謒 &F thh9UW{ F thhSEt&Ft*jT{PhEUPh}ThWL &F thhKUWJ{ F thhSEt&Ft*jT{PhWUPh}ThW &F thh^UWz F thhSEt&Ft*jT{PhkUPh}ThW茑 &F thhqUWz F thhSEt&F t*jT{Ph}UPh}ThW, &F thhUW*z F @thhSEt&F@t*jT{PhUPh}ThW̐ &F @thhUWy f~}hhSEt&f~})jT{PhUPh}ThWk f~ }hhUWiy F thhTDt&Ft*jT{PhUPh}ThW  &FthhUW y F thh TEt&Ft*jT{PhUPh}ThW謏 &FthhUWx F thhTEt&Ft*jT{PhUPh}ThWL &FthhUWJx F thhSEt&Ft*jT{PhUPh}ThW &FthhUWw ~,tuWhyTV\ u vWhtVV< u uvWhTV u UvWhyVV u 5vWhTV u vWhTV u vWhTV u vWhTV| u @vWhUV\ u vWh#UV< u uvWh3UV u UvWhEUV u 5vWhWUV u vWhkUV u vWh}UV u vWhUV| u @vWhUV\ u vWhUV< u xWhUV u XWhUV u 8WhUV u WhVVu1ۉ؍e[^_]ÉUWVSu 1tdjjVU,URJÃuGhthRj0chuhRVCPdSURP$CPhVe[^_]Í&'U WVS] SE Plƃ-E]vURE PlÃES i<+t@<%tJX&<-t<^uHECE&'EC-ECEC E0ЍxNWhVS* uK3vj,VÃt>t Vt,Cޅut&'Wh?WS u==\{t4URE PwkƃV\{PՉ'}u*WStPE PVP x&WSt!URPVF N&'hVhV$t&}tV\{/&hVhV|v'je[^_] UWS] 0ЍxWhFWSio uhhRhKWlWhMWSDo uhhRhUWGWhWWSo uhhRhaWhhRShT{Kae[_]ÉUWVSuEE ucWPEucWPheW}Wuf=X{%jjEPhX{SÃtg{,t4jjEPC,P3thhRWhhREP_ s ssuZhhREP_ }URtsjjURhX{衮ÃtXs ufsuw`{ F9PbC;e[^_]É'UWVS]} 1;t9}PCF;ue[^_]É'UVS5={ltvtdSatWhpJ jPP0PPr Pq&'}[uz`{x&'`{^t&`{Nt&Up(DPt:.&'E<>w!`{t&'`{FAK9)HEt&thhWEPV 9u9tiP W )Љ<  ǃ< @)ȉD @EH(W)߉<<؉@<D@9utE9uǁ8)+H8 8u H(0()؉0}hpJ jPPjPm Pl  849j;Ë +5W9H~NHHP4PLhpJ jLPkSS+HR8P$.vt"jR88Px <'}uhpJ jPR0PRl Qj(+8)֍\80ɉ߈щO 9~jWS<Ѓ hpJ jPP0PPl Pljj x(tY0S貵e[^_]ULu]TPB8PղD(H,ƀTǀDǀHj ]Ðt&}txuQB8PTPl(D,H@8ǀ,ǀ(j] US]t (|8t/B((9,}J(j8]]ÐUWS] ,)RSD8Pa0z8H(e[_]ÉU,8Љ]Ð&U塌@8,(]Í&'U|{]Ít&UE t&hhWjjP  P$=|{t#hhWh{h|{Qj$]UWVSe p((T8''(|8t0x(T9<vވ<vր tр tCuË5p((" t0t,y(AT8Fu<v <v ujTe[^_]Ív'UWVS,9(~M5p(щË(T7<v<v t t Ft(x(H9,}5p((9~8 t1 t,y(I9M}T7Fu<v<wjse[^_]É'UWVS(|8Eh3hW(9P]SOEP(8P胮h5hWSN$Ѕt j8؍p0z8H9shhpJ jPPCPPf PMeD8PhpJ jPP0PPf Pej4{e[^_]UWVSb,9(EhUhW(8P]StNEP(7PBhWhWSzM($Ћ(|8Ѕt jl8؍p0z8H9s9hpJ jPPCPPe PcD8PVj j 9j{d{e[^_]U,(j]Ít&'U,(joh]ÐUW0z8H(j2}]Ít&'UWVSe(ÉT89,(y(IT8<v<v t uЋ(9}D28PD 9P9(je[^_]ÉUWVS(},9~P5p(щÍv(T7<v<v t t Ft(x(H9,}5p((9~@!& t1 t,y(I9M}T7Fu<v<wʡ}\8D8hhW(8Ph4|$K\8T88R(8PjYe[^_] UVSE|(p(&|8t(FT8<v<v t߀ tCuы p(vt(FT8Au<v<v t uԡ\8D8hhW(8Ph4|J\8hhWD08P]SI EP(8P趨hhWSHje[^]Í&'UWVSMM1Lt @ P(3jn<(|8T80Ѓ$)ĉRS(ML8(D9hS8PWEPЃEPd(|9td]&ML8(D90&(|8uD9(ML8P(V={u4} u.=p{t%h*hWhp{+Gd{{e[^_]Uh4hW(8Ph4|G(D8<j]USE-hBhW,8Ph4|XG(+,4|hDhW(8P]SG,D8 hEP8PUhGhWSF,(hpJ jPPHPP}^ P\$<j]]ÍU(hThW,8Ph4|SF,D8,(hpJ jPPHPP] P7\<jY]Ðt&UWS,9(EjjP֪ E1(\8tC&' LjщH ,9vk(IT8UT7T8UED7ЅtEPEPuj\e[_]ÍvUjF]ÉUWSE=4|hhW(8P]SD(D8h4|P8PShEP8PoS(hhWS|Cj0=4|Ћ(D(=~ ǃ(j`e[_]Í&Uj]ÉUj]ÉUjV]ÉUjF]ÉUjnf64Pjn6]Ð&UWVSEj,6ǃuWhhWPFEE tj P%E]SEPKSEPKÃt8U}KF={utj Shd{訦 Sp{Phd{jà Ct8thhWPhp{BEjjje躦 tchhWEu{PCPCu uWPWhWjexPPƷPEPB:t&Eu{PCPCu uWPWhWEPMGEPhhWEP@'jj*jhhWEP@e[^_]U]É'UVS]u EjjShWjŠjcstLhhWu{PShWjcIPP藶PEP@&VShWEP@FEPhhWEP?je[^]Í&'UVS1Eh$hW,8PC‰UUEPRHƃt(j:VĢÃtjV谢Ãt=p{u2Vjji =d{tuhd{jjK tXt;u7Vp{PLÃ=d{tuhd{p{P*ÃtEPS'Shd{thEhWVhp{t?{hGhWEP>e[^]Í&'U]É'UWVSEj訚‰PLzuyUaPUBPBh{ UBLhohWR=hphWEP=$hqhWEP=jeEE)j,1ƒ9h0h0EuE:]SEP该ƒhhWEPEP=SEP聥EEE8qE8ejƒQjPRjVÃteP~<tXPmJJƃ}t hXhx(hx(j舌[^]Ít&UWU 0Ht&PhXR2 uhXhXjj}]É'U=hu,hjjh{hL h Y7h]Ít&UP|BP|~jh&Yj]Ð&P|~ j臄P1]Ðt&UhAYs./In]Ðt&UhXhXh{YqjZUSEu7jP $}E Em$[mv)hY诸 " $`N N O P P Q R S T T U V t&hYVhYLhYBhZ8hT[.h[$h\h^ hM_hl`hahbhc۷h(eѷhfǷhg轷 hh谷hi覷hj蜷hXhk荷hdl胷hlyhmov'h6mVhmLh[nBh#o8ho.h$p$hphq hqhCrhrh*s_h/sֶhPs̶hs¶hs踶h:t讶ht褶hu蚶hu萶 h v胶hvyhwohwehsx[hyQhyGhz= hiz0hz&hzh.{h^{h^{h`{h{h|޵hn}Եh;~ʵh( hP賵hm詵hc蟵hS蕵ho苵h聵hWwhXhh$h[hcQhGh^{=&h&hghhhhohoh3 hӴhIɴh迴h赴h^{諴hh衴h藴h͑荴 h耴hvhQl&hlVh^{LhsBhz8h.h$hIh hhkhՔhih ۳hؖѳhdzhȘ轳 h谳h観h5蜳h蒳hÛ舳h~'hfh \hqRhiHh4>hO4h]*h<  h4h hyv'hɣh{ܲhۣҲhȲh|農h,贲h課h֦蠲 hѧ蓲h色hEh_uhdkh}ahcWhNM h@hð6hP,h"hvh=h{hKh^hޱhԱh\ʱh h賱h話h蟱h蕱h英h聱hѺwhѻm hܼ`h˽VhLh/Bhk8vh&hbh)hhhhh h:ӰhɰhS述h走hk諰h衰h$藰ha荰 hx耰hvhlhbhXhVN'h%6h,h1"hhhYhThZ hhtٯhϯhůh軯h豯h觯h蝯 h萯hXhO聯]]Ít&U WVSEEP9} Q]:-Rz$W '^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ \ ^ ^ ^ Z ^ ^ ^ ^ ^ [ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ \ \ Y [ ^ Z ^ ^ ^ ^ ^  [ ^ P] ^ PZ \ \ ^ ^ ^ Y ^ ] ^ ] t&ztN&'ETt:-tG*v'hh(zjv'hkhREP,ztCvETt:-tG*v'hh()zj~v'R<{='{xh {xh"{xh:ztCvETt:-tG*v'hRh(Yyj}v'hhRh{t&'ztCvETt:-tG*v'hjh(xjb}v'hhRh{{t&'{ztr@&'ETt:-tփG&hh(ix>EhhVh|'Ex]hv<|x:h{!PtGlt"hh(w.&'hh(wj"|v'{{{'ztETt:-tGg&hh()wj{v'Ix:h,h(v#vztvET:-GjPRh@&ztCvETt:-tG*v'hDh(ivjzv'h:hRh{vPhfh(&vhh-h[|hxh(v j~z=PtRA:j RhP! G9} =|uhVhhh|hrÃt;h[hSh|h\hhh|M $&h_hhh|w={u+hIrÃthbhSh{C=Pu#hrÃtj ShP hqÃthghSh |fhqÃuhqÃtj2Sh h|qÃthphS&'hthhh{W{Ph$h}hh{`q%Pwƃ.=V :j,RxÃtj&F P{xÃV )׃1z8tsEWRh~j2Phj2C]Shp($DJt:}tE@DB t#)j2F Ph t:t=@ujPRh@ Vt:thhRh{h$oÃthhS#t&{t:uhhhh{=uj2hh[ h)VoÃtjPS 'h1.oÃt jPSt&@EEEjgPh6EPkEP Eh;PsÃtHSjPh@o =@t/j h@^vt@EщMƁ>SshhEP hhEP =@ujPh=h@* ={u>hEnÃuhN nÃthhSX{ jQht}t]|P1:u >uBEhhh]S EP 3hhS Ee[^_]ÉUSE={th覢ltzSt jP҃{t[CP诸jC PPNhNhCP hOhC Px C@Cl(j茰]]Ðt&UWVS}] u={th={u=ltu h!hvhj ‰Ur JBB BBh~hPEPk hh,PE PO lt EPBElujjlP'jWP h{% vhE8tu h hhEPhhE PhhEPe[^_]U{vh>&={tj賮{]Ð&UWVS]jnt=I})t|9tSPRhIt|t L)ȃulLlPpPtPxP|PSRh{肟t2 7h(t&')Ѓu Lt=ptFp...../=@|u=j2t/+H|j2@9~ jjPE 󥍅 hjVlhj]S{lVS VSBSXVSUVS.VS<)׉=.$=@|t(j3tj3D@.=xu x.‰/x9| x/xPV]S& t uXvP|t'{jfP|m&t(t\PePh5 F@P袒VS+VSSLSVSA$k(VS}u jN1u苪x.lt*vtSe t x.[$ujV AA0jjË BB+4h9~U BB0hRJjjË BB4 jZtUVƮA;Gcj)`u VtjjPqZ, P>= t jj9tHt[^_]ÍUVS]u jiPMihihH|iD|0cPh!cjdtjiPhc t&{hbSVEhjhhhjhh$={u$={ugtjjt&'jjj-jhJ j-jhJ j-$jjj -jhPM j-jhJ j-$jhJ j-jhM j -={u4u+jh jm-jhJ j_-Rv'={t"jjj<-hx(h h"i{ P@-={ujjPyjWj={t=jjPjj.Et2PjZPEP1hhEPh{̮h2 jjnh,S!e[^]ÍUMx(tB0PQg]ÐU]É'UWVS]} uCPjcu/h@VWh\hvhojhvXe[^_]US]t@Pi]]ÉUWVSU }1ۋMtYt5p9sfWMQRCVMPS,`WMQMQ5t&WMQMQr1&&'t WMQRËM؍e[^_]Í&'UWVS] uuVMQMQx}tKMtB9u a'0H9Bv SR9VMQMQ VMQ0PDMSPP^e[^_]Í&'UWVSu] >t[uev0҈щMҋETEPEPRV[S6uVat&'EPEPS"‰e[^_]Ít&UWVSu} uuhhxURUtM0} ҉ЍD9CvVU RS_&hhxURm hhx0} щMЋUDPUVU RP\P`e[^_]UWVSu0ۋ}щM} ҉E)ȍTUVE PEPhhxEPO R\\RQ`RF`e[^_]ÉUWVS0ҋ}щJ]} t0щMT {uhhxBURƋEPV[]} tWV_{ue[^_]ÍUWS]U Eu{PR0PQSPb[e[_]ÐUS]M Ut8tRQSp &'hhxR]]Í&UEM Ut :tRQP#] ]Ív'UWVSu1ҋ];t0ЍP} t0} ЍTt0ЍTBhhxRGǃ ]t PWJZ} t ] SW7^t VW)^hhx]S[;e[^_]Í'USU1ۅt&Ӏ;t p(DHt )B:u؋]]Ít&USU1ۅt&Ӏ;t p(DHt *B:u؋]]Ít&US]U ƅtEPRhPg[h7hxPSE]É'UUƅtE PRhP [hHhxP:]ÍUWVSu1ۅ>} } ?0J} H9sX&O )3t!} ;9uC} <;tF1ۀ>u1e[^_]ÍvUWVSu1ۅ>} E 80J} щH9s{t&u0щM} ҉)Љ‹M9r8=)vE t ҋ9uCI19s1e[^_]Í'UWVS1Mup1~&9"utytA9"u1G1ۊ<v<v t tC49t$1<v<v t uGA9uGe[^_]UVSEu t8u 1E&hP ÃthS t @ &{t؍e[^]Ív'UWS];tD0ЍDHP &I<v<v t tA؍e[_]Ít&UWVS}t Mu 1t&PzM10ЍDXP"uCXx"u 9tO{ tM9t>K;"u9u+'K' t 9t K; uM9uM{v'CMP؍e[^_]Ðt&UWVS]} t;u1hSƃ>"usFuvhVÃtx<"t<\t.C; uCtEXt&'{"u CPS(Ts뜐&hVeÅtC'{te[^_]É'UWVS]} ;hSƃ>"usFuvhVÃtx<"t<\t.C; uCtEpt&'{"u CPS8Ss뜐&hVuÅtC'{tt'{e[^_]ÐUWVS]}t;u1hSƃ<"t<'EE\EFuvEPVÃ<'t'<"t! <\t,ƍv'C; uC} tU EX8Cu CPSRs냍&"hVBÅt C {} tU e[^_]Ít&US]M t&%T8Tu CAt9uTT)‰Ћ]]Í&'UVSu] M%T8TuFCIt3t;u؅t$TT)‰ v'1e[^]Ðt&UWVSu ]u@Ct&'3'0щHPVSSƒ tC;u1e[^_]ÍUWU0ЍD+E Ћ}]ÍUVS]u hhx)@P9s CB9rȍe[^]UVSuE ]SPVT3e[^]Ít&'UWVSu] 0щJщMD EE9E~E)PSV-U vSVSe[^_]Í'UWVS] 0UHEu)ƀ;tX~R<\u=CPhWt}${u }\ C}G}C;u}Ee[^_]Ít&'UWVSuU}uR]S] SVl&>t0H '1E0} R]SE)PV}uUM 9tP<\u@A~Fh@PS tGhhShWS&1NhVP~ DžhhxPPt[^_]ÐUVSut-tӡp(DPt1ev'tI)><te[^]ÍUSE] t^tZ;^uPC8tOvڀ:tGv8 tB:u:t3@8u)'ڀ:tv8 tB:u@8u1]]Ít&'UWVSE u1}tYtUtQ9ErL>^u*FÍvPVSuC9]s&'ÉPVStC9]se[^_]Í&UU: uB: t<-t<+uB:t> p(DAtB:u] 1]Ív'1]Ív'UWVS] }jjWrN t1o WRQt߃ uW/PWSUR2KjV+vjjWN tWQWSURKjjWM؍e[^_]ÍUWVSu j/MQDRt%jMQrQuEt&'M9/ujQHQ1҅uUu 1t&0Ѓ$)ĉVSIރvj:VQÃtCh{h/H>~uh{Ph/F hVh/hhh/hMQh/$jh/mPt ޅd1t/e[^_] UWVSu}} tL1>t&PM QUPUt$u;$t&';\C;CFu;e[^_]UU=Tt JTtE PRhPIhhhph0PhXhUwhD|Ph;(D|Phh(hvhfjhDj+]Í&UWVSUu 0ۉ׈щH9Er %V׈щMT +EPMe[^_]ÍvUVSu19} ۈC9|e[^]Í'UVS]u x|D|EEEPYIu9t(PFPh{3}E PFOEP=OSKu^jEP[GEPOj OVG%PNE%PJjVhSSF,jMv'EPNhEPJ ut(PEPh{l|1e[^]ÐUDWVSx|D|F=XhEPh8 t3hLhxhEPhPh\hEPh thNhxPh`}XUPuUPS.Dh]hxP`jhS tjhS u(=\uESh{hkv'jhS uL=\u =`tU RSƃaShzhyt&'U RSƃUPSEChS:GU RSƃUPSChS GU RSjƃuQUPSBhSFU RS@ƃu7UPh'yh'' '1PVjE f@t Ph:yh~&ItPhLkyhZt&hhxVUR,tU\uu`tVP@t&PhnyhhxUR 1&hVG[^_]Ð&UVSu] t!jSGjSVB+&'jh 1\G 1 1Ne[^]Ð&UVS]u UM)؉E)E}Ee[^]É'USjGE=du<<)CEPOI=du&E<9u d d<+]]Ð&U{}t]É'UjUR:DP]Ðt&UVSU2Ѕ}؉2 v 10I w0tI-ȍe[^]Í'UWVS]UEEu ߅}߄t U&hvE}uE W|ME JyM~)KEF@E]K}~p&}bۋMMu 0҉I9s҉U)ЋMLMK~tEF@E]K}Ee[^_]Í'USE] ]]]8t2t.8UuA8Uu Iu\uxt@@8u1]]Ðt&UVS]3jj SVs?93ue[^]É'UWVS} EPh:hxP1ۃ9}MQEP+‹C9|e[^_]UWVS] EU2t}PhWRK uhLhxUREe[^_]Í&UWVSu] 0҉ЍDSVhShxP P/=P&Ae[^_]Ít&US]M Ut8tRQS0&'RQi]]U S];tAEjPS-=}U Um$Xmu E8u9u 1]]Í&U}u]Í&']Í&UWVSuU] 0ЍDt@Jue[^_]ÍvUU M1~ 2@9|Ƃ22]Ðt&UWSU] 0H9E~DЍe[_]ÍUE&8 u @t8ut 8t1]É]Í&U WVSE} EhhxPE j[EPCÃCj]j[V,à tCtjURWVE uEPhEPE thhxSEP]thhxEP }thhxEP EE5'EPGe[^_]Í'UEu1]jjjP,;]US]hhxj@]]Ít&'UWVSUu 0щK<.u90щH9~$SVR= u}u j.3P=Bt1'e[^_]ÐUSEM 1 8uC@At9u؋]]Ðt&UVSu] UEPRCPSVPe[^]ÍvUWVS0ҋ}щKu9] ~_vVtR0щOEE 9E~)PREP:> 'REP~<9] Ee[^_] UEM 9vtvtA@u]Í&USEM t/8tv:,tZtzut :,u]]Ív'UWVS11E1}?2< w"EDЁ4,';u E1mtCt 1E<utt@v<t<u@}t~1E1ۀ@tljDj"jOj9$j"j[j+jjbj jjdj$j9jejjjfjjjhj$j:jnjj8jpjjjj$jWj1jjXj2jjYj3j$jZj4jj[j5jj\j6j$j]j7jwj^j8jlj_j9ja$j`j0jSj?jjHjjAj=$jjBj/jjCj$jjDj$jAjnj j2jpjj*jHj$j,jFjj+jIjj-jGj$jQj?jjPj+jjVj-j$jUjmjjTjljjSjkj$jOjbj{jRjhjpj#j[je$j#j1jWj jMjLj jNjA$j jOj3j jPj(jjQj$jjRjj*j1jjFj3j$j,j4jj+j5jj-j6j$jQj?jjPj+jjVj-j$jUjmjjTjljjSjkj$jOjbjjRjhjtj#j[ji$j#j1j[j jAjPj jBjE$j jCj7j jDj,jjEj!$jj7jjjjjj j$j$jAjjjHjj$jIj$jjJjjjKjjjLj$jjXjj$jajjjhj$j$jijjjjjxjjkjm$jjlj_jjxjT]]Í'U WVSuMM] Et v0PhEP&, É}`tZxtTtPWPEPh_V6(`@t8tPhlV( hpV(e[^_]Ðt&UWVS21҉19}&vM QMQVPUCU9|B ~΍e[^_]UWVSEE1҉19u~lU`Ӎv`tIxthVhXPU U`thXhXEPU UF9uE} ze[^_]ÐUEЉ]É'UWVS}u4yvu4  4Zt&41۾t:=4thh h4 hPh4 Cv4e[^_]Ít&'UWVSuEEPVƃ5j,V*EtE0ӍSRhVU UuERhVUa UuEt&'>-u+FSE%&'5!ELt&E1ۿRPVU Uu}u }'CvȃuVhxWuuEe[^_]ÍvUE P85PPj~85 ]ÍUE PDPPh~]Ív'UUtmE@t@ &'ǂ$hh(EPZhh(EPG]Ívǂ$]ÉUWVS}EEP#t*TURE P t&URE PE܃h_SURhS u*}thySEܕt&URhS URhS upE tI8tDURPzhS"EԃCShT2 hS }4t&'1URSP& tFv߃ShSjjZt&}uJ}uСp(DPt%jj jSAEE{&]l&}Zjj jSEE<&19u~t}tUtF[ 9u19u~vt}tUtF[ 9u Ej9Eu/%PhQ[}t}u hmQ}t00}Ѓ$)ĉe؋URhUR?" 19u}t UF}tCPUR蛥}uZj}SuCP#1&'CPhRPCPhh ?v'j}uCP0t&CPhUR }t }tM[9u}t}u h *PU jjURme[^_]ÍvUWVSuu5 } 0} Hhh(jËC CCjChh(U RCP tXu($$9|V3e[^_]É'U<5]Ít&U85]Ít&UE P<5PYPhN<5B<]ÍUWVS]EE(,f0fD|h被j7萫jvjƃW$@ ` ` л @ ` MQwÃuEu PM QSVh!jC=u1 M jPMQM QVSh!jJYtjJK -PupP-P裨Ã;UjP:PhPo;u'&h6Pj7.PhA]SEPEhh(S萶$h EPhGVh!jCu h=th'jɩMtJREPu2jhhh(EPh&'W:PhPPQP&}t%jMQM Qj$ EPherLh-h(EPov'h h hVh!jC=WPhPP"n&'=%T =t7W!PhP8P vhK e[^_]ÐUE PPPj]Í'UE tV8tQPPPhէh苧Phh[mPhI]ÍPPhhȐUUE @PBP]ÍUEU R@P]É'UWS] 0҉߈JRSE@Pe[_]É'UVS]u VCPuCPVt1e[^]ÉUEU R@P轝]É'UWVSU }u` 1MtRSU׃Uދutt&'Me[^_] UUE jPR~]Ív'UWVSEUuu t 1tFEtM QSփ9~]NjuE8v'*tM QSփtڋu1e[^_]Ð&UMU EjPRQJ]ÍUWVS}u 1Ut;vU RS׃u"t&Ut&ދu1e[^_]ÍUUE jPR~]Ív'UUE h PR[]Í&US]M UE}t PQS2 PRQSg]]US]M UEjPRQS]]ÐUVS]ujE>th%&'E PE uht&'j詣3t1RE PtEE Ph5FhE PEPxPhIPJ P%t(PPE Ph`Ejt7EP PhPPP\hTEe[^]Ít&'US]huhE(hPST =ut jhȢ]]ÐUS] hPS5 tSE&hPEEPh jkh}EPL=tjjPjjP]]Ít&'UVS]utE={u t8hhjPhjE)P`ePhA=u D(Pht&1 tt&thP8ǃWhSX tjSh uF։WB9~7V)‰Phj>Z tjh"ASz 5Vh6h@5=@5t@51[^_]ÐUWVSuMfQfSD|L5<Ӊ)ىșƙ)ΉEUu)։SQ}WPhThL5F{=L5tL5ȍe[^_] UMfQfSD|jhlcPhj?hXhXhhbPhF?(PPhhbPh?j+PPhhbPh>4h@hh6hbPh>hhhTIbPh>((urPhhwbPh>XurPhhaPhV>urPhhaPh*>urPhhaPh={urPhhmaPh=8PhhMaPh=(<Phh?*aPh=]Ít&'U@WVSu }jRÃu!hih}R?hH?=vEPSj }-hih}?h?  t>uEhvhVthVu Et&hVt^hVӴtLWhQ!y uefE %PSq |)h@t&'fE%PSH }h>'h6=e[^_]ÍUWVS}MfQfSD|?191SPW˳ tS.PW跳 uPStCj ¡0WRh 2,DŽ0v'lC9u1e[^_]ÐUWVSUU5MfQfSD| EPR5EP| 9tEPlƃ|$95|FFu5]SEPܭSEPЭjWFF(PtPSn?tSWhVhhMEP41e[^_]Ð&U WVSUU11MfQfSD|jPR}ƃ ~0~qdjVÃOMMvPPCPg {u{tjP+S tEPBP{jy +C$9h腖9ECPCPEPh%MQ CPCPEPh0c$hT|CPEPhCIPjEPPhi Ph jjOE PVe‰U0HPhRct,EPaEjPEP_ƃv'EEEEEEEEEEEEEEEEEEEECC(UU}v}u"hhMFPMQ軚8hhMhURHhhMFPMQ1 j&CGtHuE&'E{ tGEhhMhWߚhhMCPW˚ hhMhW賚{t Et&EEܐSVOÃb0t EuEdUԋMЋŰMȋUċMUMU M U$M,U4MUMUM63}uh5hMh{EP蝙EPURMQURMQURMQURMQURMQURMQURMQURMQURMQURMQURMQURMQhdUREE]Sh{h{EPhjĄqEPhhPPh-MQhdURSh!h-PPh,4MQURMQURh!haPPh, MQURMQURh!h4PPh, MQURMQURh!hfPPhl, MQURMQURh!hOPh?, MQURMQURh!hLOPh, MQURhhOPh+EPMQhihfOPh+0hKhMEPhLhMEvjEPEPZƃ uHEtjPÃu(tsuh,u&'jVÃ}EܐCGtHuE E{ tGEhphMhW蟖hqhMCPW苖 hrhMhWs{t Et&ESVÃa0t vEu}uh}hMh{EPEPUR$P PMQURMQURPPPP4P,P PPPPPPPPPPMQhdUR dSjG+P PP PFPh8jĄrFPhhLPh@)PԲPj+PPhhLPh(0MQhdURSh!h-oLPh( PPPPh!h6LPh( PPPPh!hKPhb( 4P,P PPh!hfKPh)( PPPPh!hKPh' MQURMQURh!hL^KPh' $P Phh3KPh'EPMQhihKPhv'0tPF(tP' Phh JPh 'tPhhBJPh&hhMEP|[^_]ÍUWVSu]}jOEMfQfSD|{EH $ '  0            JF\Bt& -  H @9$} $({0EPhVStj P[jPBF8HN8FPFPCPhej PPEPjPPFPCPh{0j 蟂"PjFPCPPh脕Ph jj bPhoj='  FtV$&t&t otFd\&'t t&tF`{0'EPhVS jPjP9}FPCPhgF8HN8jPQPEPjP>PFPCPhvt t&tFh,94}M48?t t&tFl,tH,MQh#e[^_]Ð&UHSMfQfSD|%EPjJ]]ujh.EPh#"E<RPERPؙRPhhEPh!8EPEPEPEPhh'[EPh! EPEPEPhqhz2EPh!EPEPhhEPhu!4EPEPhhDPhP!EPEPEPhqh!DPh*!]]ÍvUEt%~t#t+t-t =t^u@u݉]Í'UWVS} ]U;u{E'U; <Sp(DPCjj jS}fHfw p(DAt CDAuUPV%>tF>u;,uCjj jS$fw‹DńPV>t vF>up(DB5CDBu#F>t vF>uCCF&Ut[^_]Ít&'UVS1MU9t5<utСp(DPt1 v'CA9uUe[^]ÍUSEhhMP9Éـ;t'<wtt t$ @A9uى؋]]U WVS] jO=|EhhMSڌ‰UMfQfSD|UR EPh sh(EPu]SEPuES}WhVEPƒh+}Wrƒh+Vrnj.W.EXEO0ۋU׈щH0U׈щHj.VEEU׈щHU׈щH}EhhM}WEP҇}}EPEP+ÃtBEPSxqƒuVShqthhMEP讆 9'hhMEP荆 hhMEPwhhMEP]1e[^_]ÐUVSuMfQfSD|EtKEhhMPhhMEPhhMEPυ]$ue[^]ÍUSEt{t8th0P萓ux{S.]]Í&UVSu] MfQfSD|؅u:PVhjrpt:jj؅u]PT>PVhhP:>Phe[^]ÍUWVS}MfQfSD|G] )Ív419}vat5C9|ƃt5t5e[^_]ÍvUVSultC ue[^]ÍUWVSMfQfSD| l3{{ujWPş hoCPC PCPhjCPhl VAP`hhMPhhMPނhhMPȂ(0щ t щ u 0щƄ 0щ t щ u 0щƄ t(RsVC P[Shj [^_]Ð&UMfQfSD|3jt=8|E=t?jt<PjPr:PhEPP,t&'jt<PhEP"jjEPjGh<hMEP轀]É'U8WVSj-tjsjP9PhjV} EUPRSn$uh{Pt&SVhP%t7?*u2hQÃtPhSMS[^_]ÉU VSu DžƅaMfQfSD|tjt2;t-=|$jPjj jWPSVhe[^_]US"CPP-C uC {hhMj*PCP]{CPCPCPCPhj=(t3CPCPCPCPhj^^P3Ph ClC tdC CPCPCPCPhj=uFPu;URht VjPh0 hP>0Ph  >=u+^Sthv URWS+cWVh~ t&WVh t&hoVjPh h[V迦WVjPh WVh y&jjWjD iURh  Wh ǼLt&URht VjPh0 hP3/Ph  WVh ye[^_]Ív'U(WVSEEEE0ҋ}щKEEjh EP蹃ƒ u00j%TEE \u'jh EPpƒ u'LhEE )'jh EP0ƒ uG0j*EE0 ~E|TuEEjh EPЂƒ u'j}t? }t'}tj}t&'D>PD> t&D>PD>PD>PEPEPt)REPhT  t&'D>PD> PD>PD>PEPEP/)REPhT $C'D>PD> PD>PD>PD>PEPEP(REPhT I(EE9Em 0щHPha S}ƒ uEQ&'0щHPhg Sc}ƒ uE&'0щHPhm S#}ƒ uE&'0щHPhu S|ƒ uE&'0щHPhz S|ƒ uEQ&'0щHPh Sc|ƒ uE&'0щHPh S#|ƒ uE&'0щHPh S{ƒ uE&'0щHPh S{ƒ u EXt&0щHPh Ss{ƒ StS胒E} ]t&]E9E~E} }uE}ujEu }EE@E؍U‹L6}t`}t(v}tz}t&'hOhMQD PTUREPEPk%vhRhMQDPTUREPEP;%hhUhMQD PDPTUREPEP%3hXhMQD PDPDPTUREPEP$REPBlEPEPEPEPh[hMEPGkCt&EPEPh3 *EPEPEPh e[^_]Ð&UWVSUDžDžDžDžE t8uRh 2'j1DžhxhMjPP!kj@PPD} vU <-t<+ukE PRAs8-u)hhM@PVgkhhMh V't&hhM@PS>khhMh S)k } uE t8uOh zhhMPtihhMP^ihhMPHi(jPE PPh PCjQMà PmPCPv tCPRo{ttJCPRot9thhMhVihhMCPViG~u PxPEu PhV/PIe[^]UWVS]uu 1j0Tp(DPt/SaEjgjjEPZjQt&jAS+j2 u{PE u{PtGPE &oPotPSh jMA} tPtLuVU RSh rt&'GPPPSVU Rh" I'uSh6 q+ GPPPShJ D؅te[^_]ÉUWVSUu 0ۉ׈щH9r׈щMT )Ѝe[^_]Í&UVSUE 1ɀ:t *494uAB:uȍe[^]ÍUWVS]yv9hjhv9chjVVj@S to;~uCShv9j@hv90v9H v~9*9hX hv9j@SvÃCSV衿>0Tp(DPƅt3j.SÃt C)0щH9rω19}j.SXG9Vhv9ht 1'jVhZ Sltth^ Sltbhb SltPhZ Veuh^ Vet,%j.V9~j.Vƃ\Ft>uht hv9PVVlthf hv9Vhv9v9[^_]UWVS11ptك} ttك} C~e[^_]Í&'UWVS11pt%ك}t S|Ѓtt%ك} t S|ЃC~e[^_]ÉUVSuƅjVSly u|!ǀ|ǀpVuhh 'PPhv'jSktk="=}" t& t!/ =u-t&$t&' ѡp(DP@u$ @C;uPh[^]Ít&UWVS1fEO}t,j@URÃtC ]t;uh t&jjjEPSPqƃ}'SEu{Ph ?T'U:t0}HPRV薾 jh V膾ǀ| pe[^_] UWVS]t1t+} t%s  tU RPhtU Rh jjCPe[^_]É'UWVSDžEPEPcÃ}t4Ut+} t%r  tU RPhtnjSU R袍ƃ tIU RSh j@RHFp<U Rh UBP4URU2h Sogu(RPh Prh2 S5gu.RrPRh8 P1ahQ SfthW Sf8DžhW Sfu,RPh] Pƿ,'RRVhd P蘿X{WCPBuCPVBt^CPhm WGjWWj^RRVhu ,jVh t&jVVjEPEP`Ãt%VSh SxjjSh ! j V袿tVh 5[^_]Ð&Ujj]US1ɡEU tE PR`jQEPà tECPh EPr C,…uoRot RCPh EP?]]Ð&UWVS}uE PE P_Ãt>h$j.S褾 uShhP SdjjS6 t&VWe[^_] UWVS}E PE P_ƃEEjgIPhEP[EPgEhPGVhS(S耻jPVh@ et?tj2Whd h hMEP,Uh hMEPUjjVj-t&'1e[^_]ÐUVS] SE P^ƃt%SE P]ƒtE PRVt&h0e[^]Í'UVSu]E PE P]ƒtE PRjs thUbSVe[^]UWVS]Et1t+} t%s  tU RPatU Rh }t&CPCPhruVYE~t#u(@PU RhxE@Ph $&PU RhxEPh hMVXSe[^_]Í&'UWVS}uE PE Pg\Ãt.j@S莻uSh SSS&VWye[^_] UWVSuEEE 8E PE P[Ã<-t<+uthQ Si`t6h SW`t$h2 SE`thW S3`uShw;ٱE c8ZEb}jhVA` u w;f ,&jhV` u2 w;f6 f{;jhV_ uW w;f[ ,&jhV_ uQ w;fU f{;t#0T)&'0щHPhS[ƒ u DžHw$U t:uh>9'1u9hhhhhh jm0t hP‰փvVu0RFPhAS讳SP7ƒOt&u~u*~ uO&'uGFP.uӍGPU t:ujFP|RFPhGTt&'uWFPuU t:ujFP0RFP@Ph PKUvuwP܉PFPRY )F(PF0PF8PFHPFPhWjlwF(PF0PF8PFHPFPhfHw4thP臮FPPtt&ujhhhhhhhhjvͪ$t4@PhhmRRh ~t@RFPFP@PV tJvV1ɅtJQhjuG~u ~t&'X RFPFP@PV tBPVtBPi'Rh ~ u~t'REP|Ph$G6kP臘uP}u*@PPhT'@PEPh-u.uW@Phy vytuE PSjӞPh uR1PhPhE PS uv Rh P賎0jj藧[^_]Ív'UWVSM119t(=)<v<w C9uFA9uޅt2S$V<$0fÈ@s~ v1e[^_]Ít&UWVSu] 0ЍP1>t"8uF>t8t@F>u>tF>uރ ~1R$P<$8fÈ@s~ 1e[^_]Ít&U4WVSu1ۡDžjK:u{0҉щȃ$)ĉVPhjW $ B$} mE uK%@lti'ctR%dtKst ut6VRP-Vt&FPdRP '0щƄ %g&h@P觨0ҋ&&0щ $ };hjWb [>O%FЃT8$- `. 01 01 01 01 01 01 01 01 01 01 / / / / 0  0 @0 `0 0 0 01 01 01 01 01 01 01 0  / / 01 01 0 . 01 01 01 . 01 @/ 01 01 @/ 01 `/ 01 01 0 01 . 01 . 01 01 01 01 01 01 01 01 0/ / 01 01 01 . 01 01 01 . 01 P/ p. 01 P/ 01 p/ 01 01 01 01 . 01 . G1' vfVF 6&   t&t&t&t&twpt&'tWPt&'t70t&'t t&'!Dž" #y'$i'胤DP $Hٽ ٭$[٭'&tpPW葟?tG?uFt&$= DžFoPjPVP ot RWh hMPG? ?tv?u G?ut&FG>$ };};t PW裢 $[^_]Ít&'UWVS}u Nvh hMCPCPY?h hMCPCPB? h hMCPCP(?h hMCPC P? h hMCPCP>Nxh hMURGP>h hMURGP> h hMURG P>h hMURGP> h hMj5PGPh>e[^_]Í&'UWVS}1E H9}Y1ۍvDt@|t9PUROKu(DPUR:KuFE H9|1e[^_]Ð&UWVSE11PS蘜*~h1<-uxp(B[uCtt DBtjj jSeƿ ;p(DBC;t+t%p(DBuCtt DBtjj jSݜDž;tp(DBtCtm;utdt^<-uZp(B[uCtt DBtjj jSyƅut;tp(DBtCt;u9} t|9u ~9} t|9u  t&'1[^_]ÐUWVS}] uu]jFuOMfQfSD|\ Pv'@jP؅u j֔P}ƒ uDMfQfSD|e tSPHFuKz0uEMfQfSD|l BPP1Ѝe[^_]Ít&UU~S<#t-<&t)<+t%RhLhh~Sh&'hRh~SPI~S]Í&U塨 PP0u;hPQhj PPDŽ0]ÐtupRhz]ÉUWVS}E 1tjj jPʙh hMj|8h hMWCP9st"9p}‹ut9p|9ue[^_]Ít&UXWVS1ۿtXBt9t$jOPhhr PEPG EEP@@PhhV蓘{9ZtPBPhVPh{Xh hMP7$h hMP7 $[^_]ÍvUS t2=udQQ2j莝9};Pjh hMh{#; Ph jj hoj ]]Í'UWVS]t|;tw0Tp(DPuVj.SԙǃtGD3Av'ߍt!1ېƋ3PW@DtɃ<u&[^_]ÐUU1t jRh071҅tPЉ]Ð&UU1t jRh0tPЉ]Ðt&USE] tBjPh0Ճ t.tjHh&SPI6&jJh&P`5]]É'USE] tjPh0utX]]Í&UWVSMEE}, ,ˋK΅u{V{t{VCPh&uˋ !tCPh'h'Y uptCPh"'h'1 utCPh('h' uBtCPh-'h' u0CPh2'h' u&h;'] t;uQhM'It&E PSh&j,Í44 4fDfDhCh&W?1C hDh&M Q&1CM K Yt&'hKh&j,És Vh'o3CM KhOh&M Q0C Sh"z1e[^_]ÍUWVS}1tGvCt5U RPCu$tv'&ދu1e[^_]ÍUWVS} 1EHU$@E &'E PF H F H H H 0G H H H H H H H  H H H H H H H H H H H H H H H H G Wh !Eh~h&PD+hh&EP.+hh&E P+$hh&EP*hh&EP*FsvWhpEEhh&P*hh&EP*hh&EP*F$륐t&WhBEhh&PT*hh&EP>*hh&EP(*$hh&EP*F 댍Wh0eE7hh&P)hh&EP)hh&EP)$hh&EP)F 댍E4WSEtChh&PP)hh&EP:)hh&EP')$뮉~cvWhuEtKhh&P(hh&EP(hh&EP(F$멉'e[^_]Ít&UEEPh,UwEu 1]Ðt&@Phh&EPQ(hh&EP;(hh&EP((] UWVS5X'1d11ӋE'1EEd1E1U9Mw9re[^_]ÐUVSE PE P0ƃV[@th !ЉÃht&'jjVjjjVjà jjVjjjVjà jjVjjjVj à tV9SVh(h(jjh,(Ph)(gt&hJ(膽e[^]ÐUS]jSkt)jS@P kjjCPRZА&Szlǃ ]]É'UWVSE} u5u tZ}tu>tE(u jEu FF(t}u"1i&'uP&lju 9su4uVCPg3u }u#}uċ:( v]u؍e[^_]Ít&'US]E((D|EPit`E9Xu苐tރt%'hh(P$ Eǀ뙉']]É'UU((D|t(jPR%]Í1]Ív'UVSU] EujPR t$jPSh thh(VP$e[^]ÉUWVSu ((D|jVMQjà tqC3C C(hh(CP\#sC4@C8hh(MQCP$S SE'((D|jMQG^‰U((D|hh(hdE"C3UPR@hh(MQCPH#$MQPPo &MQBP{EMt&'((D|Zhh(BP!hh(EP!hh(C,P!C $hh(CP! CC(S"St C4@C8sUPR?SFF(PnC0C1jVMQVz FEE((D|vEPfU9Buߋ2t( tȃ}uU샺u tt"MQP.uU9B-EpMQPb.[U9BJMQBPyUS4BC8hh(R 0t&MQS41tBPyt C4@C8p؍e[^_]Ít&UWVSu ]1UU((D|"U:*jSRfǃ s>+u&FS]PVf- uSUR1G1}t%S]PV;- uSUR0G0jWVcà ((D|8jURURV?REh;h(h]jCTC,C4CLCvtuh(hQvt&h(hQvDžtEM9Su}]~tjtu1h(Wuh(SuFPSuh(Wuh(SuFPSxuDžtnt&~tgtu1h(WNuh(SCuFPS9u9 h(Wuh(SuFPSuDžt~ tmtu4h(Wth(StFPSt h(Wth(StFPStDžtnt&~tgtu1h(Wnth(SctFPSYt9 h(W=th(S2tFPS(tDžt~tmtu4h(Wth(SsFPSs h(Wsh(SsFPSsDžtnt&~tgtu1h(Wsh(SsFPSys9 h(W]sh(SRsFPSHsDžt6YU0u}tEPRh(t&1X[^_]ÐUWVS]u 1PFPƒtNF09tBu>؈F0jV.TÃtfVSFP  SVTÃuEt&u=F09t5u1jǃC|SVSÃu߉e[^_]ÍvU(WVSE1EEE]SU R|E ((D|BPLPMQ %EURh(}EM 9t]܋U K/$c &'d i d i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i e g i i i i i i e i  g e e e e d i i e e i g E 1E t(Mh(UtcEMQEPOEuE{?'jh{URXp EE1Et&(U |(M `(U p(Mx(U l(MUREPƃPIPV$ uMPWUMP0jMPUROËMQUPS@P t Py jMPVhOà t0{tC|t"HC|t&'tH}Ux0t"}t,MQSPV0&Sj9&PS@PM t& d(Mt3hh(UREP,PM Q  v'hh(U R M@#'UREPƃjMPV(Nà t{PGPVZ UH1UREPsƃjMPURMËMQUPS@P t Pw jMPVMjVU0PWEt@PVt?hh(j6Ehh(VPO EPM0PU$E@ xu/hh(EuPDPEPjnUU؉B}Mx0t{SRPVURi VM0PVEt?hh(Phh(EPhh(EP$tMU &EЋU!E M 9UPMP}tjj jURh&}u v1e[^_]Ít&UMU ((D|jRQ u {]P ]ÍUVSuU M]((D|}ut>jQRNE t+UB,PB1PB0P REPSVƒtEP(e[^]UMU((D|jRQu 1]Í@ #E ]ÍUVSu((D|td0tZEEh h(Phh(EPvhh(EPc$]udž0e[^]ÍUVS]u tYjVS tPE+EPEP@ jVS ^ tyjj- k&FF(t)vPE%EPEPs@ ؅uڋFFDŽ(Ue[^] UWVSuU1Dž((D|L}hRShj S`lt xW跇jQW]jMQbch[h(Wh$]$h\h(Qh(?WQh(j=c tAQWjYPh(j^EhP|Ph)Wh)$jjb}tqjVMQà jSM QGƃ QWMQVm7}~QWMQV8yFF(tZvjSM QGƃ t<~tQWCPV6}t~tQWCPVb8u[^_]ÍUWVS} U]uzPt E+BT~KB8HJ8u>B t@t1jPuPVjPePWCPh>)BHe[^_]Ð&UWVS} jgEE((D|MAA(M9NjVMQEà Cp~0EPhSVVt#EPMQVSWMQgv'jPbtH=Dt?jWhDN t+WWFPhu)GWFPh)GCPMKThh(WCPVSD6e[^_]ÐUSMU ]((D|t1jRQ t!x3tjPSDt &1]]Í&USU] ((D|t4jPRV tjPSDtxt t&1]]Í&U WVSDžƅ1ۡ((D|EPJjEP)Dƃ Ihh(PPwPEP4tJQE@P:Ru)R t+RE@Ph)fƅ1ۃ,V0щhRP ~tB0щhh)P hFPP hh(P VEPBƃhh(PSFPEP4tJQE@P9Ru)R t+RE@Ph)5,hh(S[^_]Ðt&UWVS((D| BB(jVtjVPh)覒 h)薒jXAA(tSu=tj195~`1j}X9t-h*,8(tSulF95&h*e[^_]ÍUWVS1jUơ((D|& AA(tjQV"à tu PP(0( kC9jPCPS unC49ucCPjXTCKCPh)jZjjlPP+ j衠jCPh3* PKc f PP(C9jPCP%S unC49ucCPjSJCPh)j#Zjjl:PPk jjCPh3* Pb'fe[^_]ÍU塆((D| AA(t"9HuP:#tЉ]É'u1]Ít&UVS]M ((D|9t^~YAA42(tH~-SS(0(DŽ(e[^]ÍUWVS}E((D|vEP3=t,E9xu胸thh(P ŐGG(tvVHV3ޅuGGDŽ(W e[^_]ÍUVSuFF(tqvStPVCPP C8PVCP C,…u{R{t{RCPh;*V=SySuPjjVe[^]Í'UVSu((D|t;V@PR` t)XCGt&' PP(tjSV: uu1e[^]Ít&'US]M((D|} t2QQ(#&@TtC=t3v9BujRS: uu1]]Ít&'UMU ((D|jRQu ]Ív@0]Ð&UVSEu PP(tjSVo9 t@ vu1e[^] UMU ((D|jRQ@u ]Ív@1]Ð&UWVS} u((D|tH|DFF(t'CPWu9su MK4uڍe[^_]UVSU((D|-ƅR BB(t;v9Cu"hCPV+hh(Vuh7h(P<[^]UWVSu((D|>^9}J=}ECCv}(tJ9|IJulC9]ԍe[^_]ÍUWVS} 1~&EXPURNuWE9xuO9u ^hWh(EP hXh(EPt&uFEue[^_]É'UWVS} 1t%vURPu9{us [uމe[^_]Ív'UM1t9JuRu]Ív'UWVS}u t1WP/u9su[u1e[^_]Í'UVSu] MURQjSPUMRQVNRQ8$ShG*jP4t)UMRQVNRQ $ShP*h S?jjRGjjPe[^]Ð&UWVSu}tqVPuXE 9CuPC Cu3jVE PǴ t VSE PV\!t&1[ue[^_]Ív'UWVS}ut.vPW{uM 9Ku 9s us Y[uhh(jhh(WVM KCs CUCPR/ e[^_] UWVSu}tx>tsto?tj((D|hh(jChh(VU Shh(WCC e[^_]Í&'UWVS}u ((D|tIt?WPu(9su#CPPhv*V4VW*&[ ue[^_] UWVS} 1((D|؉][ URPrukE9xuc9u @ @ F uhh(V7hh(EP!hh(EP$xuj&e[^_]ÍUVS1((D|ti؉][ 9u @ @ F Eh h(Vuh h(EP_hh(EPL$ue[^]ÍUUE jPRt @3]É1]Ív'U塨 PP(vǀǀǀǀǀǀǀǀǀǀǀǀǀǀ ǀ$ǀ(V]ÍUVSuNtfAA(tIv9s4u;t1PCPu h>h(PC4 ue[^]ÐUWVSuNtYAA(t<}9s4u.EC4Wb/tUF9Bu9tS4uǍe[^_]ÐUWVS}1ۅt?/uCt}ujPQKƃ }t&'V jnj]SOfEW}WJI}uI0@PSV:M }jV]Nzt&}fj0PL0@PSVjIjKt&'}jj]SNfE EU ffEjSV|L Dž||PSVQ tVQv'fEċU f}u.jV^M}VaQq }VV`E}&={tMjj\SMfDž\`fDž^jSVKtVPjjlPMWÃuVPCXpC PXRQvH fDžlU ffn}t Vw|3j0P JjlPVlG}jI}u VP"jI&VOvL[^_]ÐUS]S#uS]] US]jjISTMj[I؋]]Ív'UEPt=@BPBPBPPh*h]NM]]Í'{]Í&USUEEEEEPEPEPEPh*RKEEUE ЉEU% ЉEU% ЉEjhHjjEP[GÃ(jOH؋]]Í&'UEPDu {]Ít&jdPh]I]Í'UWS]0Tp(DPtS Sje[_]ÐUS]jjSgM tPjSSMt1]]Ít&US]jjS'M tPjSMt1]]ÐUWU|%t8t0H1}]Í&US=tAjCjCh*Pv19}vB9|]]Ít&'UWVSDžp=u|u huOjwh*j¡hB jyh*h hG GhF 9FuF FFj hGPUKhFtTd0dЍp$)ĉRSLBShP=BGw GhF9F r#} Wh*z EPhTu VB uh{}W&}u*h~ h{}WhF V)RP} W-Fà I tSEPWh*gy0h{uVJAI0t&'hG _ G$t&DžtDžxhj|SGU M  | tPjjSE @PCt? tv~u Vh*xh{}Wq&u Vh9+bxh t#h+IxG  G H&hh+&xh+Lt(gh{uV?t(}t`j hGPHuFh~} Wh+wh{uV?gt&'h3&h}p>hG< tFpW9W w͋p}D7<> t 1 t&pX[^_]Í'UWVS}EDžtxltHx| Džl=u h1,hjURD1ۃ 9|_vtFB9B v>j RGt+pڃp TtC9}tu+lVjM QWBRX@&'u 󥋅t`[^_]ÉUVS]|A=uكu Љ9}؍e[^]Ð&UVS]كt !‰t2t+hh*PYhh*PASPF9u!Kكte[^]ÐU VS]EEEjEPj jS@juVjjS@E(jVj jS@e[^]U,WVS] E0ЍxEE1Ej hV,S@ tjhe,S@ u. Mԃt AA`Eu 1!G$)ĉeSMQ;Ejhv,]SN@KE(EE]SPjh,Vbu jVEESPǃEj.WCt;MqEPVWj1Ph,h'M6SEPTEtj!PSEEt 8t@EjEP!}(EPVWj[1Ph,h&t&'EPVWj31Ph,h?Pדjh,S> tjh,S> MZjh,EP> uM&MMEPj0Ph,h ?P@Ph,PjrM vj h,S;> u E)E]SPSƃt>-uSEP;ƃEPEP)‰UEPRVjg,Ph,h:P G Wh5.EtN8M }EPWVj,Ph,hr:P'WhS. E@M9 }]SWTjhh.EPz9uSEP1SEP'E܃UUEPRHM@t jP}tAEPMQEPVj-+Phm.h9Pэ EPEPVj*Ph,h]9P蔍 jh|.W8 t(jh.W8 tjh.Ws8 udPMEEURPEuPVjM*Ph-h8P-j h.W7 u|PMEE]SPSEPEt jPyEPVj)Ph-h'8P^'Wh.蕽PME E]SPSEPSEPSEPE tjPE EPVu.Pj)Ph,hm7P褋 Wh.ռt~XM4}]SWOSEPCEtjP1E8(u EPWjg(Ph-jo6PJ'jh/W6 u|,M UUEPRǍEPEPƃEtjPE8(u EPWVj'Ph,h/vjh3/]S5 uf0M@ E%E]SP!SEPǍEPEPEPWVjI'Ph,hK/2jhk/S 5 tjh}/S4 dE{jh/EP4 t My:t My:u1vt4 <f}EE]SP,SEP"tu'SEP ƋEEÃthjSW&SEPSEPSEPESEPƋEEà jMQEtjP]CMQSVj%Ph,tP:4Pqjh/S{3 u|DME+EURPƋEEtjPE@PVj=%Ph-h3Pjh/S2 u|HMoEE]SPSEPxEt jPfEPVj$Ph-h3PKjh/S[2 LMEE]SPEE ESPƋEHM@Et jPEPVEPj#Ph,hi2P蠆t&'jh/S1 uu j9EjVjURÃ=BujVWURh-j&'t9V8PURjPh,j1_,P薀Ph,\ B'EV=EEEVhf0藱EVURh,UR"'EPEPj/S(/t)hho0@PEj]P/t]EP8PURSjPhm.jj+PPh,\$Vj8PURjhjjVURj (hho0EP A&'}GjVURjX VURh,jG& ttjVe[^_]ÍvUSE PP`ESP‰U:t81t t&<1Ph,hA1xPh,Uhho0EP=]]ÍUSE tKPAA`PË BB`&PPtÃSsEPhUhho0EP蒾]]Ít&'USM] }u QQ!`AA `]]UWVSu 1=u&jjhZ1XwPh,S&t >t BB`VSlƃ9t# PP`hS&=`t3޻`vhh{V(hPV;uhh{ShhSh~1SSh1R P%[^_]Ð&UVS}h1ƃt+VHC jjl PP;kb |Phthү'1PPPh15<PnÃhho0h1S輼CP} t S jSj C@Cjp Pj PKjjS30 jjlPP(j(`h֮thŮ1PPPh1V<PGe[^]Ít&'UWVSh荮1UEU UURE PÃh{Suv'h{Su1v'h1Sut0h1Scu Eh1SEu'h1S%uURE PQEG%t&u,h肭P,Ph,h1uhRuy'h6u_P%P5VhxhPPh,h2rPh, O,&hƬU9|h1r }u=tP  &PE jEPjb =^S<PEt&'=uG}tAURt1h1 ËURPSj@h֫PPh,h32qPh,MUe[^_]ÐU WVSUUEPR.PxW}1ƅEPEPhPVx C~Mj[tVh[2h V'h Vƅ1닍&hh^2V l&j[裪tSh[2h SKh SGGDŽ,j[h`2P訶1[^_]É'UWVS}EGGXt/ujgh`2CPV÷jhh`2h^2V豷 uԋMtIGGDŽ,jjQWhi2蔼 Ph jj19=EVEXPEtMhh`2Phh`2EP԰hh`2EP$u!Vh2 uVh3GElG9=i19=~y1S UXhh`2RKhh`2EP5hh`2EP"$XEulG9=h93FU&'<+uF>2j*VBthM3Ft&E19=1ېVXPUEt?hh`2Phhh`2EPRhh`2EP?$h!h`2j ˮEh"h`2V8‹EPPXP} lG9=Oh%h`2E@P]SMh&h`2h^2S8 Vhx3Et&ju+}t{=urPFt` PP,u?j[ǡt EPh[2h Pl&h EPh@h`2EP }tj,e[^_]ÉU WVS =XhjSo ߉ƅ1ۅt'vCh^2WFPW6u܅t~QtkAA,uIt@ j[腠tWh[2h W-&h WeB [^_]ÐUWVS] jƃjVSh3ŅǃjVPP(Rà jP3ttGtnjP3tYVMQh3BPkPMQh3C,…uo2Ro2t^2RVMQh3\e[^_]ÉUWVS}u jEuI1951ҍvXtC ul@9|vu{jjWBBXP;Ã`}t{ Lhh`2WCP薫hh`2VCP肫 hh`2Wh|j{ j[Cu{PCPh3jL tI}Cu{PCPjPh3jn4PkcPh[2?}tfVW`]&'CPh[2jK0 t8}t2CPjXPh3hPbPh[2a?C C{uMKC { j[ugCu{PCPh3jJ }Cu{PCPjPh3jl PDbCCPh[2jI0 t5}t/CPjXPh3jk PaPh[2d>E+CCMKC e[^_]Ít&UWVS11=Xth3UR XtNvFCPh3UR ~)h3UR ;th3UR 1Guh3URg tWh3jU t Wh 4>e[^_] UWVSU u{10Ѝxt!WSRU Ut FuShe[^_]ÍUWVSEMAADŽXXMMjFPMAA<XP u_hh`2j Fhh`2FP豪Chh`2FP蛪CC $SXPhh`2FPMQhh`2h^2MQ詧 60j[襙t^h h`2EPX tsMQtFPh[2h P6uC'}t4MQth EP,h-h`2EPve[^_]ÍUWVSM} E9 h9Yt&'AAXt%ut9{ uCPh^2VW uދEuhAh`2h{e[^_]ÐUhCuu{]Ív'\Ph44h^ ^]UWVS] }1:4>4fB4fD|SujPS~ƃ tPSu u}o{jdh:4jwjeh:4URCP葤}tjj jURCj C}tjkh:4UR蝧C S0P1e[^_]Í&'UWVS]E1EjPCǃ-!!$ t&      5  5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5    0 &D4E4w4n' 5^'.5N'H5>'t5.'5'5'5t"tWU Rh5V3[Ph57}t"tWU Rh5UR[Ph5m71e[^_]ÐUS]E jPBPSh5hPZPh5)71]]US]E jPAPSh5hMPZPh561]]US]E jPAPSh5h PDZPh561]]UVS]u :4>4fB4fD|tSP;PPS ughh:4Sh2PSh5j$ t/SPjPh5j/@PwYPh55t&1e[^]Ðt&UWVS]U :4>4fB4fD|jRR@ƃt;Pn0HPSPPPu1j:VtA{t5R{tR{t5Rʅu{R0҉{t{S{tR7Ph54e[^_]ÉUWVS] :4>4fB4fD|{P>3{jVC}MuGCjj jPPWVjPh5hPPWjPVx thh:4WPמWVjPh5hP/WD'jSX>jjPjEPh5hPVPh5N3e[^_]Ít&UWVSu :4>4fB4fD|t}~twjV=P0HPMQRpu?PS轗FPSjPh5hP%VPh52e[^_]UWVS} 1:4>4fB4fD|2tt&'PÃPSԩPPPSPSjjjW<PPK+\'$P t&                                    0 P p  h5P&h%6Pj~t&'h86Pj^t&'hO6Pj>t&'ha6Pgjt&'ht6PGjƃ t/PjPh5VSPh50 PPh5/ jj[^_]UTWVSu ]E0Ѓ$)ĉRW$p    @ `  &jVjW:~?~5~ + FPӾFPžF P跾'R萾Rp}RP mjVjW9VtR% ^ R$= 8$h6]SvSPh6h6QPh5-( ^= 8$h6S/SPh6h6AQPh5-( ^= 8$h6SSPh6h6PPh5_-( ^= 8$h6SSPh6h&7PPh5-( ^PhP7hS7PPh5,PhP7h}7pPPh5,( t ^Й '1QPh7h7(PPh5, t ^Й1Q Ph7h76t&'jVjW7V t2Nt+APRh5hK8OPh5, vEEe[^_]ÍUWVSU] t@:t;t7r8 t#BPBPSh5h8;OPh5+e[^_]ÍUhWVSE:4>4fB4fD|Ex)})E8)EE:tUjEjj EE أ\ t1ӍvE 9C uEPEPEPCЉƒ )uԋU J$P ' [ [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [  [ [ 8  8 x  [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [       [ [ [ [ [ [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [  @ ` [  [       @ ` [     [   [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [   [ [ [ [ [ [ [ [ [ [   [ [ [ [ [ [ [ [ [ [      [ [ [ [ [ [ [ [ [ [ [ [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ `  [  [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [  [ [ [ [ [ [ [ [ [ [  ` [ [ [ [ [ [ [ [  [ [ [ [ [ [ [ [  [ [ [ [ [ [ [ [ [ [  `  @ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [  [ P h86$jPEPP jPjP$jEP-EPEPh5\P2ƒtEPEP |9:+0REPh8S&'EPrjEP-EPEPh5\PƒtEPEPGj EE$!tXuvCPh 9EPb StRh 9VL &hh:4h 9VKuMt,]څu{R{t 9RQh 9Bhh:4EP|hh:4EPiEPEPh5\PƒE PEPEPƒ %EPEPyt&'EPEPӝYt&'EPEP9t&'EPEPst&'EPEPst&'EPEPt&'EPEPst&'EPEPCt&'EPEP3yt&'EPEP3Yt&'EPEP賤9t&'EPEPt&'EPEPt&'EPEP蓦t&'E9@!9@'9@ cPtN BBUЋLMQEPƒtEPh-99t&'EPEP9t&'EPEPt&'ExjP9E@PE@PEPEPhU9\Pƒ E@PE@PEPkRha9EPjRE@PEPEPh5\P)ƒJE@PEPjHRh5j=  PP<tE@PE@PE@PEEPj-'EPEP#t&'EjEP'jEPhzƒt&E@PEPEPh5\Pƃjjzhh:4EPEPqh 9EPà PS2ƒu9jEP&hyƒ t,t(EPEPJt&jPS hh:4EP&jEP&Pƒ u!EPEPh9 t&EPEPh5\PƒjtKEPEPjRh5jR>Rh5 t&'EPEPC PPDŽ`hx hoxPPsPh8[ 'EA R荽0 EPEPe 'EPƒ EP'ƒ jEP$EPEPh5\Pƒ8jEP$EPEPh5\P[ƒtEPEPPW] P5耕 BBtEPh5h PejEP$= EPh5\Pƒ Qv'jPjPcjEP#EPEPh5\PNƒ o EPEPZ jEPU#EPEPh5\PƒtEPEPh{P9 RBPo&'P%tN PPTt/REPƒtEPh9\&'jEPu"P躿ƒ u!EPEPh9&EPEPh5\Pƒ={t(tEPEPw{ &PŽPh9jh{P誕={ P蟠P]SjjSh h9葔 w 'SľtM PPTt.REPLƒtEPh: t&jEP!PZƒ EPEPh5\PƒtEPEP=h{P蚔Uв~ S肣9讲tPS`EPEPh5\PƒtEPEPjhP苺jE@ PE@PE@PEPE PƒEx@ jj jPsÃE@ PE@PE@PEPEPh0:\PWƒxSE@PE@PEPPh?:jR8Rh5{$1vE@PEPEPh5\PƒjRhN:E@PEPPh?:jdR7Rh5(t&jPEPݍƒ hqtJEPPEPhV:\P/ƒt!PEPRh_:x$} l3jqtU PP0u4EPu{RE@PEP' PP0uE@PEPCst&E@PE@PEPh5\PƒtcjCtUEPu{RE@PEPh5jCR5Rh54} mjote PP0uDjE@PEP  BBUDŽ0`t& PP0u/:C PPDŽ0v} t} t } u5EPEPƒtEPEPh: PP8tEPEPp&v PP8tEPEP>6 PP8tEPEP( PP8} t } uA BB8tDŽ8& PP@} L} ?E 2.} t } ujjE@P"} t} t } u%jjjE P&'} 1urtg=8|t^hh:4BBD(P y BBD, 8|jjPEE11E8t!U:0щMЍ\ F:uhh:4]S%x‰U EtR{tE1E8t0]th 9EPPEPF;uӃ}tjEPEPEPh5\PEƒutJ> PP<tjjj :t&'h`EPEPh5\PAƒEPEPRh5軖} murj;`td PP0tCjE@PEP BBU0 W&h_t>jEP EPEPh5\PZƒtEPEPEPx[^_]ÐUhx(jjh;b]ÍUhx(jjh;B]ÍUhx(jjh;"]ÍUhx(jjh;]ÐUh jP;  t<P9 t&[= t  蓻j]Ð&UuTh jP8sP Hh jjjP2 P艁1]Ív]Í&US]SjPKS5U]]Í&'US]=t?t;hjhM^E PShhM^=M^t hM^]]Ív'UWS]=U =t0ЍxvRShN^P`uPhM^$ƇM^ =t+M^v<wt t$ @A9uhM^e[_]Ít&'UWVS=}u uhT|uPh ;hM^0M^ЍXuVuVhM^Wp =t.M^t#<wt t$ @A9uhM^e[^_]Ív'UUtLE M^PRhhM^=M^t%hM^h*;hK t hM^z]ÍUU tSEPRhhM^jjo=t hM^)jjM] UVSuV"Ãt;u V辣Ãt;u{P'jhW0|0Ѓ$)ĉeRPE8t{vEPEPlÃtbh8Wt~uVSRNSVyjuB0HPSVq t 떍&'1e[^_]ÐU WVS} E}tUB txu?WhlVPS;t$WtjPW<ƃ u1jPrUzEj jURF tha;t&jjUR# t h;zt&j jUR t h;Zt&jjUR t h;:t&j jUR t h;t&UR't h;URWhu;EPhh;UREhh8;8P]SWbj@EP8PPURWh<,h<URWhu;j TtMPj8PvPWPh*<gPh jj TPh6<j hh8;S`E Et(EPh7<ihh8;EP`=HjPHƋHtoCPUR[gtTWCPJtCuUzu9G$ '              p p  p &EhVh8;V]SREESPX[ËEPMQ8PQSQ ,uEPMQ8PQS&h\h8;EPQ EEjVڬ t[ ou  vu@8u}u*th=EPЧth=EP軧PuPMQQ  M1PVyRu"@PPV T 6&PVQ9CtPPEPVEVh7<j7蟣>+u7jPVRjPVRVh=Љ t&'VVVh=賉tRMQ3D&'jj8PSWPMQV"E VMQ8PQPVNQu#}tMQjQMQ1 PV( MQ#jhV8PMQ}Ej 5tH80Tp(DPt!j@SrB8PMQREjV虡jV8PMQWvǃGPÃtpCPCPh6=j<t8jCPCPj Ph=j]|PPh7< GPVMQ8PQ$EPEu8u>PVMQhq<j6]}t|jMQMQ蝅 tfP t_EPB u6<PVEu8u>PMQj<Ph >j4謥PPh7<H(PvEPVEu8u>PMQjPh=j>ZPPh7<$}}My0jP=DjMQhD MQQMAPh>kMQMAPh2>Vj /3 tHPjMQMAPPhS>FPh jj 2Ph6<js jjjjl2PPjjPݕjj8PMQj1e[^_]Í&'UWVS}u 8;<;D|jjFP8PWBt:u5h+2P}PWh<)t&>~jWhh8;FPh{ ?jFPj@W菖(t[FPWh6=j5gtCFPWj蔔Phh<j<P;Ph7<{Ph^>$jP{Pà uj{PytXt&jPHu| j 0t_{tVjP8PWÃt>P{PKu&Ct Fu6<P{Phv>趃 h)h8;Wh =Fu6<PFP8PWjh1e[^_]Ít&'UVSE C8;<;D|4SPh>jkĜt3SPjPh<h^PPh7<1e[^] UWVSu} E8;<;D|BPzÃt2P;xPGP tj.V*uESPh>j]S5h{PO8M裘jjl.PP (j.Vȣt)Vh>^jh{Sjm&}tjS蓛Gu>PVh>j%t;Gu>Pj9Ph6=jA詟PPh7<Ej$ .tPنj -tjh{EPjmjjP1e[^_]Ð&US] 8;<;D|ljSPh ?薀1]]Í'U WVS}U EE8;<;D|{2PxPWG u VPEčjh j8PWE BB(tU}uVCPW8PWTjCP趘}t VWCPhh<j+tEu}}tVj _,jjfjPWAPI}~VWh6=jE辘tiVh?WjPhq<}u*PW~APat`bR%P\Ph7< PVWq6 }u jj8PW8jj8PV(1e[^_]ÍUWVS]U Uj1{ CP蝹{u }+t6}-u~ + ~'/{|~+  1@'C|URURDtUREPURh?}Ge[^_] UWVS]EE8;<;D|} }jMP#My0jZ)uMQh$? jMQMQzǃ jMQ轕hh8;S :‰UEPR?EG tMQ@P$(E%Ehh8;EP9EEju>v<-t&<+t0u&'jMQSyNjMQSMQEPWOE(F>shh8;EP4 }tBEPEPMQM QMQjHPh >j踙PPh7<T(hh8;EP~4jj5e[^_]Ít&'U WVS] 8;<;D|jS3[j.MQ蓜jtPV8PMQ$jV螓SPvhD' tSVMQ V^jVPP(R訁ǃ t7jPt"SVP PSWPPVMQ`,SVMQ8PQ(PpqPMQ@ t"PSVbQWSV8PMQ SVMQhh<j?tSV<u8PMQjPh=FtP`PPh7<$t&SVMQhh<j?aVMQ?PfpPMQ? u%SVh<MQjSPh=hovSV<u8PMQjPh=h; SV<u8PMQj߇Ph=jFOPPh7<$SRejjPЇ jjĐ1[^_]Ðt&UWVSu UE+E0Ѓ$)ĉRSn8;<;D|O]EPS9V߀? K$@ vB B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B @B `B B B B B B B @B B `B  B @B @B `B @B B B @B @B B `B ]vt&'}+uEPEP=8PPj+;t&PEPVMQh6?j@&,EPEP8PPEPVMQh(?j@$G?/L'߀?t<<+t<-uE&'PEPVMQh6?j@覎G?uōe[^_]ÍvUWVSE EEE8;<;D|MHMpuA?jPMQà tjSMQprE jMQo}B}80jSMQMQj~VMQMQMQ8PQ ,PkPMQM; BEC8PҀǃC,thh8;PEP-jP$PD &' E  E pD  E D  E &8hh8;PEPo-j@EP tEP!EjPjhh8;EPP,;t&'jj jePjJ j jNPhN?rjP³tKE…u{R{tV?RMQhX?r1tGPPMQ< hh8;EP+ u{PMQMQMQhq<j8Ƌt;VMQMQMQjPh=j@[PPh7<$PMQ%jjPցj?&MQPqiP8jhMQ8PMQSt[VMQMQMQhq<j8t;VMQMQMQjPh=j?臏PPh7<#$jSMQnǃ {0}EPhMQSjPDZj P跱9~ MQCPhd?p K'G8HO8u5EPHPEPjPgPMQCPhr?ApWjSMQMQ]jjPMQMQ%jjPjj1e[^_]ÍUWVSu} 8;<;D|>jW{jS裈ojPStjPjPVhm PSj謗jhS8PV%tkGu{P8PSVhq<j9輈tCGu{PS8PVj~Ph=jBIPPh7<$PfPV6 uIPS"PS1:PSe5jjlLPP}*t&'SV8PVjjPVSQ#$jjPO~jjj?o1e[^_]É'UWVS]} ujVPW؅u<Phh<jN}t$tSPWh?3PWh?"e[^_]Ð&UWVSu]EPVihSh8;jd&‹hUh8;VU*UBM JfDfDe[^_]Í&US];tjhlCPPq;u]] UWVS] 1jMQ:i4Ët6CPMQ4ut ߋu1e[^_]ÍUWVS111ҐltA֋C PCPpPrPWCPhJ@UMGMK UuG~Qh}@!e[^_]Í&ULWVS@8;<;D|}U:0}HD8 uH8 uU{<:u@Ph7< t&MQh@jS MhURVMQQLjSPURn WVSW$ƃtS8PPWF Ѓ=<thLY<jj jW蘄tSPPۍW'jhlWSƃ t*SPFFN  SWP[^_]ÐU(WVSEEEEEEEEE@E=|fuEPj |fj{E P1EuE @E PE P+PI(ƒ <-tu-}uShA&]SjU}u ]SPNt P}u P}u]SPG}u P}tUj{EP.u'h*AM7t&'|fPEv]SPPP]ShGAte[^_]Ív'UVSu ]V%;t#vV@P谆t tÃ;u؍e[^]É'UE@t8t 8u]Ð1]Ív'UWVSu] hheAj CS[%7GGhheASGPG e[^_]Ít&'UWVS}]W[EڅumAjEPRM QÃuhheAjGt&hheAjƃ FhheASFPW1e[^_]Í&US]M CEuC.A9}EtCEB9|EMhheAEPMhheAEP:{t1]]Ít&USEP!h heAUR؋]]Ðt&USEXtO؉]xthheAP }thheAEP 뻍&']]É'UVSu^Ctjjh{PhoAu܃} t Ve[^]ÐUSEt#vS:t퍶'huA趴]] UWVS}1_t#CtPFVGPhAԲuߋGPhA轲e[^_]ÍvUE@u1]Ð&B8uЉ]ÐUVSE5hj7hPj7PhA]S@"EPW.Ej)hAS$jjjjMcjjR5EP[tEPhA莲j1Pv'jhzt jj5EPhACjrj;hAEP<e[^]ÍvUHS]En8h{uE 8=LtZ\hAS(t>E t\t1-u,hAP(uE PE P#n E t8tPhAEP ,t&h Pj7 PhAEP| EP,Ej`hAEPEPEPjc| EPhfyE@hAEPHu3EPRhAPݱjjhAEPHK=n u jjP} jphAEPwL<Tjhf]] U0WVS]1t  vj] t+sPNHPh+SnЃ tV0щ uщƄ ShAE P诰 :v'Ht R~jvH1&NY[^_]Í&UE t)tS*Ct&j‹BP ӋRG9~$9u6B Pڗ‹@ tPBP hhBM QRiF$F~,tJF$F<php jF FPjP) PW'<ЋM QjF$HN$@9F$F$F1e[^_]Ðt&UWVSu} N|.AAHtjjjWPQWFPhEBjp.Wj4PaWVUjfj/<t v'FHPWÃ;t$PV t PV;u܃~,~8t;jWwt,$FPhBF4u\V<tQ F4t6j[KNjFPhBˤW/KjjPMe e[^_]Ít&'U\WVSDž{11DžDžDžDžDžDž=xtpx=tu&hhBhhpt(ƅE8uEBj:t3j,jDžt&Džhth Džjjj1u Dž{];  ڃ*$pd f f h h f  e h e @f h h h h f h h h h h h f h h h h Ph h h h f pf h h h h h h h h h h h pf t&t9~3F$ @F kv'~19~#F@u Dž}W)л)É19 BFG9E A9Džu Dž&u Dž,u ^v+v'F ѡp(DPЉ Fu(ыp(DSt Fu/ ѡp(DPtBЃ F8,Pp(DS,FƒЉFu(ыp(DSt Fu/ ѡp(DPtBЃ FvjKiu"F[FFGy&u3dwdKv'd!tudv'<v  d$i 'i 0i i i i i i t&Pt5)`(|[7&[uMd ddt&dTt&p(DPt>d2<>w(duGF9} ~ u E HtB9|(Z)hhBPhpt+Ƅ(hhBSpPc( ttE 9}_щK9s@ $)ĉSPhBS,m+ 8u;t( u9}+ tƄ.0ҋщT Ӏ)܉VPeSPdSPh0щNDžDžjKƒDžDžsu,dwdDvd+tudv'<v d$m vm  m m m m m m t&PtE#)(? [u{dy d^t&dNt&p(DPt8,<>w"ddA9+89Ƅ5t(hhBRpShhBpP xp[^_]Ít&'UVSu] ~$tSV8v"Pl‹PhhBSP@H@9} u3tH@9~tWtNu džH @9|jVW1K9~2XPHH9|иe[^]ÉUVS]u <S{,tg={t^|PVaj|hp jPhp j,P$x(tP0RcC1e[^]ÍUWVS]E={'t&'%$p &'q r r r q r r r r r r r r q r r r r r r pq r r r r r r r r q &j=t&j-t&j9t&j t&jjBj jd{hp jLPE 'C=p(DGt*pCw!DWttBЃ D0Ѝ4C;,u?C=p(DGt.CHCw!DWttBЃ ɍDЍ CKQV&v'Et&'PC}tp<1e[^_]Í'UVS]={9Cu t hBhƃ19}v@B9|{,tG={t>{TtVC  SJt&'VC + SRPPЃ )s{,tZ<X{Tthp jC  t&'hp jC CPjP P <Ѝe[^]É'UU9u]Ív't tEt{j?thp j P1]jthp jLPf]Í't뉉'1]Ív'UE9u]É't tEt{joothp j@P1]jo?thp j(P]Í't뉉']É'UU9u]Ív't tEt{jthp jP1]jothp jLP]Í't뉉'1]Ív'UU9u]Ív't tUhthp j4P#1]Í'hthp j8P]Ív'tv1]Ív'U WVSu} h'~hp jPu ~t"FPhB]Sx`hp jSCt"G(PhB]SQ`hp jSu6u1j1j'hB]S%`hp jShp jLPe[^_]Ít&Ut<t@] U<tP]ÍUUu<tƒz%]Ðt&UWVSE }E={,u=}uUEG9u~ vPW9t [F9u}t29u~"<hp j,P F9ujWMWe[^_]Ít&'UVS1ۋ5ltvtSF$t 쐍&uRhhBhC$ t^$뼍lCC4C0x(={t jC()ǃǃǃOǃǃǃ,ǃ(C8ǃ0ǃ8ǃ@ǃDǃ4ǃHǃLǃPǃ=u}؍e[^]ÉU,WVS}fU fCW%P^U%PZS^1ۃS^C~jjj'!jjj !jjj!$jjj! u|h.hBhPoB  8SPӍ&P@PhBjPoUh6hBh#P hBIUuhuBBt)8tSP*uCCCPFhGhBPPPW\j\&UWVS={h'CPTt&h/C?Tuh4C薉u6hmCTt1ۃuh4Cd tqCuBt&'wCPh~C fDžjjjjjPjǃ}WhC菊*v';WXt t%5vV hC谈t&'WjPSq Dž\hjpS9X pDž` Džd `PjjSj 'Th|cXQ;W[VYj XQsU؅PCCPhCvt(PhDf\PEPWTF4F, }V&PZhDF,PVF0F(WhZhjpS%WF, p`PjjSj 'S0jF,PlSZ ~3hhBSPV30jjx&t&F,PF,Vj XQ8T1L[^_]ÐUS]9uhD藆C,tK={t PC,C4PcYC,PZY'@C R16S u9u h3Dǃj*}]]ÍvUVSu={t2lt(tC, [$uٍe[^]Ít&UWVS={5lF,ЋUhH|U=@|t@|jjPE ={jF,PQ0 ti0Ƅjk6tjjh{R'jjjQj,"&hKDFjhlDj({ 55FPO{@hPF,PURǃ~Dh19}=hu+P}C9| {795tV'jhDjR v$[^_]Ít&'UShhmCMuh'CMtwj(GPP*tP) t&DPhPhDhSWMhp jS(x(tP0RN]Í&'UWVS]uhhBjhhBSahhBVOGMOM OGMO <L$Lt Pxu:<L9uj茘e[^_]ÉUMx(tB0PQS]ÐUWVS}u1 t&EB9BB4v9uJ{9{~{{R&t&RT= thlhlD00DŽ0DŽ0DŽ0j}hDD(PL 0} tqU :tiItRURhDЁ U RhEhRJj0HPR0PzL 0P 0~ P DŽ0DŽ0l9/[^_]Ív'UWVS195~o=}1ۉ}~} }DK`u#~} lF95e[^_]Ít&UUU=u4Pjj jRaIPPh%EZhhDEPT1]Ít&U WVSDž9  15>~i؃M tLD>K u?DžPPS O tD8PQF*8؃Mt(55jSQ tn&8h{V]tPHGt&'IEP8PhfE| D:K 9txFFDK@tXPhEj|DŽ:DH% DHDŽHPV]9 .:@:hEjU<PhEj0JPPhEa{85l9501DžjQ} ~UhEj%oEt3hEj;PhEj0 JPCPhEzjVt&8t!8PhEzh{Q3t&jVbt+8PhEzh{VADŽ8t&' I tVShF{ j]J¡8Q苾h-hDPjjlC8tct(etquT=ujI:&jI+=X~h{VjV0l9 [^_]ÉUWVS0ҋ}щK]195Ev} t ETt9U t } E0I9M}]SREP &QR]Sƒ tYE]TtY0I9M}]SR&'Q]ESEPlƒ u( ElF95e[^_]Í'US]StS6|9]]Í&'UWVS}] {UEEEEW*j:WIt+EPEPEPEPW'j[WpItqGjW(?191tD0 tPWEtlC9Ot&|t7t1SPESPESPESPE Et8t PEjEPEPEPURWe[^_]ÍUWVS]uE PMQ‰hhDB J JUPhhhDMQNj BBU <}t3hhDEP_Nj QQ| = QQDŽDŽDŽDŽ`M Lt;thhDSD:Pwt0>t+hhDVPPTR=vBB|uhhDhPDPP6Puv}= BBUM Lt#;t%hhDSD:P8t&|u-hhDPPTR t8>tQhhDVPPTR(Nv PP|u-hhDPPTR }0҉HE J JU<0։H9EvhhDMQӉ]Sne[^_]Ít&UVSuE95VhFyr5h hDFFPh hD؃ P hhD؃PhhD؃PhhD؃(P$hhD؃@DŽDŽDLD0WQ $uVSh+GQi= jj2jjP)1e[^_]Ít&UWVS]=9u1'}XߡPSt]CCu>ƍvlC9u119tIM QSI0tǡPM QHjPj.o&W hMGj%O2t0h\Gj|(PhEj06P#PhEge[^_]Í&'UVSEu hGPb7ÃtAShV2 tjVVO ڍv'Sr7& '1e[^]Ðt&UWVSu1Dž hG1tshhDhG1PSP‰PRhhDS(hhDP~ hG|PhGSQPhhDS4$VhGSehGSƃt}+uVG}?t=E PWjSYƒ jSj''P@i-ukE}?tPE PWÃ9uhI/av'h-ISe (t&'PHPn5} WEP=VSƒuHt.9t*SMuV@tV3PS< jPj&SVce[^_]É'UWVSDžp PPDžxDžt}l牽hvhjlW/h | tPjlWg }5h|t jV|P u Džppuhj]S>/ DtPjS~jV|P|\[^_] UVSuFF\LLD1ҡ8tv BB|(u8|9t(thhDVD (P~|,uj.¡T,ht jjajc,Xhκtn(t^vVh詺bIt_IRjPhfIj,P7PQ=PCPh}I $uVhNbIt_IRj5PhfIj+PP@DŽDŽDLD0Vq VLH =e[^_]Ít&'USM] t!9 ~AA]]É'UM|9 1]Ð&AA]UMt59 ~-AA]Í'1]Ív'USU] |39~+ BBt DŽ]]Ð&UWVSMuACC42 U RQhWDŽ00H=uƅhhIV? ItVRhIR VRShIj]y0HPVRw hyuhIOt(PEPS6SSZ'=uDSh Jj% t0h\GjPhEj0PrPhE#O[^_]ÍUUE PR ]ÍUSEU EPR]]Ít&UVS195~H1ۍvt P%t P lF95e[^]U WVSEDžDžtt <1uƅ1918t[thSt&D8t(hPVdhh{VT&Sh4JOlC9hhDPP膸[^_]ÍvUWVSE PE Pt&PƃhpJMvjƃuo=2195$1ۉVʾDŽP]PK lF95t&E t8uJ'NjFFuhJLhJj%t=DPhJj PhJj0WPoPhEKVʽWVDŽ 6=u0h\Gj PhEj0P(oPhEKe[^_]ÍvUVSEM 5Q ÉكtbhhDSBBDP+hhDSBBDP 1j QhP 95~g1h#hDhP؃P赵h$hD؃P˴h%hD؃P豴(lF95č8v PPDt PhJ5e[^]ÉUWVSu} h7hDW^^؃Ph8hDW؃Pϴ h9hD؃PD 95uj WhPm jjPk jYe[^_]Ív'UWVS=čt>h[hDPPTRTr Eu4FEu4FTtRTtR t&hPEPEu4Epu4Epuu}0щNET 9r5BuD u?D }0щHuD U0HwhJRD&'UEEEEEEEEEEEEEEEEUuVEPe[^_]ÍvUSE] jj jPSP]]É'U SjzP$hJG ={u6hKGPP]SjjSh` h-K$jjP]]Ív'UVS] jj jSƃSV@jVe[^] UE PPD]Í'UWVS}U :5E PRùS t4SPHt4E P!&'E 8t@ ] E 8{uj}j{@P E jjWE Pj5e[^_]ÐU,WVSEEE=u}t}u h8Kv} tE 8u"hKKm&uv0} HE11pEPPE PU譽 U؅u1;0щHEԋE9EtBu u|F~ulE Pƒt:E PqEEH=vhkK]+t&'E PhKDw'}}:EPhK]SjjhPzS‰UtRUvEpE܃}j_hKj ȭ¡BEE܉B }}D}jjhPzEPEjjhKPխjkhKEEpv'CR}1ҋ Mt9v]E9u9tƋCB&'ڋBEuЃ}uE PhKPCt&'}|:E<p6jjjjEPu'}jjhPzEPt‰UhhKBP衬E@E tSE@hhKPqhhKEP[hhKEPH$]uhhKEP+ }}RExt\EPhK]S-jhPzjS6‰Uh` E@PBP(&EURphhKEP誫t&}uj1=t'WhLS tShL@'E PE P螳Ã0ЍxWht&hhLV耦p t&hhLV`  &hhLV0 hhLVp hhLV hhLVХ hhLV谥` ~t&hhLV营 ^t&hhLVp >t&hhLVPP t&hhLV0  h=hLUPj!j.MP<$PUhhLV訤  &hSV脤 hHhLP蝘[^_]U$WVSDž1DžDžDžhtLDžjPh{] SJhPS覣hahLP(}M Dž9u8wP tuv'<v $ v' 0      t&ƒPt8)(2[u{y ^t&Nt&p(DPt8,<>w"A97t&} ;U&'} WPW Dž] ;M 9 u/u&Džt&'<p<h<`<X}d€u-wEt&tuv'<v $ v' @      t&ƒPt8)(2[u{y ^t&Nt&p(DPt8,<>w"u3F0v'uF&']<9A9h_tƅ  ] \3u FPW/h tV]<9Wh{@)+PhLVHt&']<9}A@)+PP育PVW] Ssh'WV[PjX)tD}t>]<+H192} \B9~1] [^_]Ít&UWVSu t>uhhLh{\t&ƅ> 11ۊ<%F>!uFtСp(DPtFFY$ &   `           p                 0 @ P ` p              0 @ P ` p          0          @       P         p & `          {hhLPz Wp K ; +   P   0 @   0  { k [ K@ ; +      p `   p  $        0 @ P & @ ~' n' ^'0 N' >' .' 'p ' tFNv' ~'p n' ^' N'` >' .' 'P ' t !hMQӃPP#'hPP۫F jjKg{PSMQShhLSӋ[^_]ÍUWVSu11ۉEvhhLEPMXDŽ #M Hyt+ t?vt+5'$(,t SWVM‹ M#QX @#~ECjjVEe[^_]Ít&'UWVSDL.jKy@1U @BP9Dž8?>]Ít&{]Í&UUBEzt;jjEP0t*axtAABA]Ít&{]Í&UUBEzt;jjEP^0t*bxttBDED]Ít&{]Í&UExt 0u{]ÉUE@u{]É'P]ÍUEtjP#u{]ÍUMx(tB0PQ)]ÐUEЉ]É'US]= x0u}jM]u}ujK]w;h j@P @% x(tJ0QP5&uKh j@Pـ x(tP0Rj?5h j(P言_Ëx(tJ0QP;&x(tP0Rjv'x(tP0Rj ]]UWVS]} 1;t9}PCF;ue[^_]É'UhLjHP \t"h jjHPRh P h jHPjPA P x(tP0R]Ív'USj]f9%{{t hpjHP]]UjP]Í&UWVhMƃuhMp&VPzVhMh(4qhM|u PhM|u DžhM|HVhM}VhM|VhN|VhN|,$VhN|Vh N|VhN|VhN|D VhN~|VhNn|$VhN^|\VhNN|X Vh N;|Vh#N+|0Vh&N|Vh)N |T Vh,N{ Vh/N{@Vh2N{(Vh5N{4 Vh8N{8Vh;N{Vh>N{LVhAN{ VhDNr{ =XuVhGNV{X=uVhJN:{=u MN=,u ,ON=u QN=@t =(u@{({=4t =8u4{8{=t =Lu{L{= u  {=tP=tG=t>=t5=u =Dt#=\=Xt =hSNh(hNh(=uhNh(=uhNh(=uhNh(d=uhNh(I=u=Duh Oh(%=\u$=Xt =uhOh(h'Oh(#t&=u MO<   =t   =\t P = t =0u( =t=TtP v'  HhLjpL %|={u %phpjHP+1^_]Ðt&UEPhTHP}*Eu Eu   9 u 9tAt]É'1]Ív'U]Ít&Uh jP+x1]Ðt&UWVS] u~ =u8=,0&'$ut&h jURS\PWy Pw }'h jURjP/y Pw h jSjP y Pbw 19}h jWKw C9|h jjHP\Px Pw1e[^_]ÍvUWVS}u ]~Mh jWjPx Pvh jSSPkx Pvh j)@PUvh j)@PjP,x Pvh jSSPx Pfvh jWjPw PHv$h jSSXPw P(v1e[^_]ÍUS]h j0PuPn1]]Ðt&US]h jPuP>h jTPu1]]ÍvUh j Pu1]Ðt&Uh jPku1]Ðt&Uh jPKu1]Ðt&U塐x(tP0Rj1]Í&'UT00%]ÍUjvQt,h jPt x(tP0R] U}u x0%p&%xπ p hpjHPX]ÍUMx(tB0PQ]ÐUWVSE{EEU6t&} WE P#fÃ-;$jhOOsVk uFWE PeƃjhOVj V jhOVj WE Pet8u"URhOTh ƿOtƿOuE0&'PjE &jhOVj uPZI${}=VEP$|t,tJP$Ex(xP xu,hhDPP'XhhDPE PXhhDPEPW v(e[^_]ÍUWVS}u hhDPj4QWj‹Pp(hhDPMQPOX }tMHQt&' BP vPPe[^_] UWVS}1tkU R{vPCP艽 tCPCPCPWvF؉]hhDPPVhhDPEPVue[^_] UWVSM1jмM,V9W$P(PFP P趥uT19(~$PWtC9(䋅$P,P P芒W2tH PFPhLPhOj&'FPFP+PMQ 6h@hDPPVUhAhDP P@U[^_]Ð&Uh ] Uh s] UWVS}] EEP)tGuvS+Uy1ҋCPCPRhgPVZEPWLh\hDPV|T(ue[^_]É'USU1t @uuRhvPR'EPhPhPhPhPhPhP; PhP$t^vS+Uy1҃{uCuPPPC$PRCPhPh袸P PhP> u]]Í&'UWVSuE0H vF h{Vuat&vsVx9E} VxEuj E@PerPE :'tVCP`tӋuj VU RAb1e[^_]Ðt&UVSu=${thPv'EÅVEP/`uhE9uvExu,hhDPPQhhDPE PQhhDPEPQ1 ]EtVhQe[^]Í&U=tP=u]ÍUEP$u1]Ív']Í&UVSut$VCP_u &u1e[^] UWVSu}1ۊPEEj jP衶 hhDPj4EPEjUBr(MJ$B,}$t M$A @B0}tM Q&ÃuCUBC(B(}u S$EP$E@t8?t3h&hDPW#T‹EPh'hDPM Q4t&'h+hDPCPS‹EPh,hDPC PS‹EP M Q_'EMHtx@ =&h:hDPWS‹EPh;hDPM QeS‹EP ]SM Qt%SEPЮEP?0'M Qh8QhBhDPEPN1e[^_]ÍvUS]=tK9Hƒ:uC]]Ív'US]ju 1C& tB)9}Ëu tB)9}Ëu؋]]Í&'U=uhw]ÍvEP_@+Ey1PO]ÐUVSu ]1ɀ;t`*t ?t,u Nt&<wL ʁt1!C;u1Ѝe[^]Í'US]j@CP膰tghPLt$fEv'jCPt``ffvSh05]]Í&'UWVSj@MQMQƃ0~VCP6uVCP%uFM QCP$uM QCP轲u}tCPh0ښÉu t&hP1MQCPS6uMQCPwuXM QCP#tD}tfNtt&t fFv'ߋt1BjM QO1``MQCP5uMQCP误uP}t*fNtt&t fFv'ߋu10tzMQCP4uMQCPuLM QCP"uM QCP賰u$}tCPh0ИÉv'u1e[^_]Í&'UWVSEEUUEU䋚t3vhhXQj +IljPURuЃEE}~EUUEU苚`t3vhhXQj HljPUR葖uЃEE}~0t9UUvhhXQj wHljPURAuЋEe[^_]Ít&'UVSut%>t vhhXQVxH ue[^]ÍUWVSEEEEhj@U R胫PRƃ<U R蛼PGP2ËURGPB ƃ9]}(9u}#u]}Gt}u31R'}tC9]u>9u}9u]}Gt }tURP%1t}?YjURƃ<`U R˻PGP1à 9]}@]}Gt*}t$URP蒭% t&'1t}?u1EvU싺`tfvU R;PGPQ1à 9]}@]}Gt*}t$URP% t&'1t}?uEF~=0URGP{ƃU R襺PGP0à 9]}!9uu]}Gt}u,1K}tC9]u>9u}9u]}Gt }tURP8%1t}?U}t'}u1 'Et&'Ee[^_]ÍvUWVSEE1t+ECPCPFPFPWh_Qu׃G~1`t+ECPCPFPFPWhuQtu׃G~10tCPCPVhQAFuVURURhQ$e[^_]Ív'UVSMu ]uy1ҋ8u6Bu>u`1 vu>t&<tʃЅvۉ';=uhj@APu jAPƒt]B>u>v6`(Bw>u u`1<tʃt Ѕu0 '1e[^]ÐUWVSEEt8u1 'jPhRQ u ECvjEPhRP u E? jEPh RP u EUREPiǃ?WG=Pt PPW蟨tP;u1҅u=|t|PWkt;um' uX&Ee[^_]ÍvUWVS}=Pt=Pt)hPh6Qhh&Rh"Q;uɾ=|t>|t)hPhPhh&RhP;uɀ=t jhPe[^_]Ðt&US]††1ɺ=Ptt1v0@A҃hh(RSBGhh(RVBG$hh(RURBGhh(RURGP+?UWj趤G WjW e[^_]USUE E1jPRqE jP hh(REP=hh(REP= hh(REP=hh(REP=hh(RE P=$hh(REPt=؋]]ÍUWVS(R,Rf0Rf2R D|}t4Ut+} t%r3R tU RPJtU Rh=Rt&EPWbE]SEPEEP>bESEPESEPEǃ SEPEPESEPEËUBPƃ}tUBPt&'UBPVh^RBE }URSWPUPSP$Mt&'WPIuhASX%vWEPh`ShfSPh>Sh:h(REP+;e[^_]ÐUWVSE(R,Rf0Rf2R D|EE@7EEPEPje‰U jBPBPE thMh(RPy:hNh(REPc:hOh(REPM:$hPh(REP4:hQh(RE P:hRh(REP :$?v80195~L18(t+j@ PS~uuՁlF95}t } @EtqEjPhgh(REPU9hhh(RE P?9 hih(REP&9hjh(REP9]u195~I18(t'j&@PS~uuفlF95<@e[^_]Ð&UpWVS}DžDžƅ(R,Rf0Rf2R D|thSW!Fu Dž] SE PCAƃV>M>-uNuhSVEhSVEu DžSE P@ƃu>] SE P@t8u)StSPhS@t&'SE Pv@SE Pj@WP#LFE ;82Rx\Wl\SE P@PZ\ËHwSS2w$SfSfSE PE P?~hSP0~hSPY~hSPștt%hT'hTP藙t jWEj!V2Ãj@VDžCt@PPSh^R<u5WoPRRuPV]$&RuPuPRTu TPhThh(RP4!&2T6T:Tth;TP1tMh;TSRWRRRSh3 Vdt&'t,WRRRPh3 VDd\RRRPh3 Vd1&hSj'URW&[^_]É'U WVS]EEE (R,Rf0Rf2R D|}t!M9th?TQAuE U w:nE PR$<Ãa;X} u(hSS@uhFTj *u VE P;ǃt?u%lT}teTPhSZt&VE P;t8t PWEE t8thh(RPt&hh(RhtTEP2j!Sut6j@Sft'MQEPWSMQSs.&'EPWMQMQh~Th0 Sahh(REP1t&'SMQe[^_]ÍUWVS(R,Rf0Rf2R D|)19=EU(tVjSCu(UPCPCPCPCPh)Ujs8tLCPCPCu8UPCPCPPhUh輐PPh>SX$EPEPS7à t5}t/VjPh?UhePPh>Se[^_]Í&UWVS@11(R,Rf0Rf2R D|uhEU&FuVh(Uh(Uh]UhThUhdUhhUjgǃ t#jh蛏PPh>S7h(Uh(UCu8UPC PCPCPhzUjf蕊 t?CuUPC PCPCPhUh&P]Ph>S¿ %t8t4<PjpPh?UhݎPPh>Sye[^_] U VSME(R,Rf0Rf2R D|}E1EPEPj@'C t'PCPCPhUhUaPh>SƾFEPEPSà utVhU̿"&hU趿 U :EEE PR1ƍEPEPj3ÃCPV uCPVtmE t+8t&hh(RPC P)#'hh(RC P ( VE Ut 8tURhVؾ EPEPSà V&QhVEe[^]ÍUWVS]E1t} u1v'U :*u80} u&1{0Ѓ$)ĉeSPņEPEPNÃt1t+tRQÃtVC P8u1Ce[^]Ít&UEE(R,Rf0Rf2R D|Mj7j7Ph>SEP*EP6Et.jPtEPhVhEPhWh(REP#hT|j7^Ph1VEP*&hT|h;VEP) jEP 6Ejh{Ph{ h_h(REP#$h`h(REPl#]Ð&UWVSDž=@Dž D $!1Dž(R,Rf0Rf2R D|qhT|j7DPh1VSS5hDVPpu+ShFV耹h}h(RPz"t&PSh`SjW謂tShfV:PPj`t&C…u{R{t{RCPyPCPCPCPhVQpF PPSà ut"VhVjU tVhV蔸1tOhT|hVQ Gu(UPGPG PGPhVQބ?Fu̅t"VhVjU苁 tVhW1=DthT|hWQ荄 t2APh1WQe F uυt"VhAWjU tVhQW蔷thT|hkWQ 1t[yu=A…u(UR(UtWRAPhWQ跃F ut"VhWjUX tVhW01tIv{ t:uhT|hWQL C PCPhWQ0Fut"VhWjU tVhWkQvQQ4=QZQ)t_tJt5t SuKUD D.'H'B'NRhWQAPSh`SjV~tShX}Q薄hh(RPhQ[^_] U WVSUUU(R,Rf0Rf2R D|]SR.'SEP"'SEP'ESEP ' tPLCtZ>tUtQ?tL}tFM9t>jVPP(RkjjPWb PVhh(REPC1e[^_]Í&UWVS}E(R,Rf0Rf2R D|t?tjPWƃ u'jl{u{ tS{| ~DPCPCPWhXEP"jjEPhR jjh(UjkE8SVzaÃujjPWh?U" Ph@Qjjh(Uj#1e[^_]Í&UWVSUU MU(R,Rf0Rf2R D|]SR$SEP$SEP$ESEP$ t P@EWPV0 taMQYPV tJWV{uM APhXAPEM APϗufWEP记tU0tOhh(REP~jP0u M yu1M APGPhXP\hh(REP/E e[^_]ÉUWVS}U(R,Rf0Rf2R D|t:tj.RB}} |M APɮe}[SPSPMQ 3j M PÃtjz+ w OMjM APGPMQHt xt?M APFPHt(}M APMA P$t ~ytVuoMQM APt$hPjMQjhXM QjytGPMQM APhX)e[^_] UWVS} 1EEE(R,Rf0Rf2R D|}#U:?}MQW h h(RWEj!Pztu@Ev}ufjURWVà uQj; CPVtCPURt{ uSMQ+WÃujUP葙My0}t Uz u{ jwE}tMy '{ tUBPGPuh)&jMQURUƋG |%EtGu7F txu$hPjMQjhXURMEG@th}tbMy uYA UQh1PjMAPjh YURMAP}t UBCPh YW(G 2*~ t7hPjMQjhXURE&hRh(RFPEj@PjxChrPjMQjhXUR;0hNPjSEPFP Pjh YMQ j " tRjjSEPFP PUBPPhXPh jj Ph(Uj\ hYh(REP& Gt,t(F t@tjhYFPjjMQdGu }}UB+E~9B MJhFPjUBPjh YMQ &UB @B MJhPjUBPjh YMQSUz|ttBM)ȃ<~6hPjUBPjhXMQ}UB|M쉊h|h(REP h}h(REP 6&'hh(REP hh(REP 1e[^_]Í&'UVSu~0=@~jPFPhPtd@tTFPC P_t8{u2VCPu!hgPjCPjh YV3uV4e[^]Ít&'U]ÐUE@D ]Í&UE@D]Í&UEU t#hhfR@ŸP ]Ít&hhf@ŸP ]ÉUEU @Ŵ]É'UShfhmhfjahfjgUhPj I hfh7hfh(hfhjhfP7$jhPPhghhghh0gj7$jxh jhh:ghhUgh hWgjDhegjhfSE PJ}tgh@hfEOP RPhQmtPPdP臸PhWm&hIhf P Ext,Pu$PjUB PPBЋE` EP u nRPh;mؔ taUBFB t!hYhfPF 'Fh\hfE Pch]hfEPPe[^_]ÍU WVSU} Eu tuhn2'7EWEPEPWhjhEhhfjQ‰U tB&'BEhhfjNjExE@4ŬhhfE@ŬPY‹EPE@ŸthhfP-‹E@P UEP t&uWh)nWh:n1 E@PW uE@v'E@FhhfE@ @ŸPGUB @<ŬrhhfEPhhfEP(&'uFE?hNnWhRnv'EEPBtjt$ t;tVtt&BPPE@Phmns[&'BPPhn'BPPhnB unPPhmn& hnE@E: hne[^_]ÍUWVSEE1E PE PELjhnEPƒ tjhnEPƒ uzEM {t9tRM {t 9toREPho]SVjjEPja$hhfS E8-u @EE =0Eh jEPh0DGƃt]}0щHPEPCPƒ uEu΋EPFPYƒt EEuE}u)EPEPEPEPhjh}uE}}"uE@tFuE}}t NvE@ }t,U u{REPhQmjeXE&E}}!tN'E@$}FU}!VE PEP,&'uje[^_]UVS=t51۾vthhfVo uՍe[^]Ít&UE hhfPhjEjjPE]ÐUEP-u 1]Ðt&]Ív'UEP-u ]É@]É'UEPt-u 1]Ðt&@ ]É'UVSuVB-ËCPV6. {ujVu.؍e[^]Ív'UPtFPEjrhpP jshpEPjthpEP(뫍v]Ð&US] PusP‰Uu{PPB hhpEPihhpEPS hhpEP=t&'u{Pjͥ]]ÍU0Tp(DPtj tjjVMà jjFURUR؅uPURURURhp\P2G(EjhKP Phqp|VگP؅uPURURhqhKPПPhq5|4URhqhoKP覟Phq |؅uPURhqEPmjh%qEPh%qhǃ t7GPGPrPh'qhJP6Phq{EPUR蛿Ãt6CPCPC PCPh-qhJPPhqO{ utMGt&'C PBqt9qPh'qh^JP蕞PhqzhohpEP$e[^_]Ív'UWVS] jS茅;SUSUS U[]}}jFPSWhOq\P[?t)hqSh'qhCP6Phqte[^_]ÐUWVS}u PjV? =tC4_v'tOjjA>FPSWhOq\P>t)hqSh'qh_CP薗Phqse[^_]ÐUWVS}u PIjV~ =tC8_v'tOjj=FPSWhOq\P>t)hqSh'qhBPPhq[se[^_]ÐU WVSu =jV}jj&=^FPSQURhq=\W=t{SEEIA])Ӊؿ<ËEUvu{V}WSQhqhAQ Qhqore[^_]Ðt&UWVSPM 9)PXÃPp WS>P‰UF<BPPVB hhpFPhhpEP(hhpEPhhpEPgjM Q5|jj\;M PMQh'q\P; t1h@t jhn@P襔Phq qe[^_]UWVSP\ǡPjM Q{M ;!CP  SVsAPE‰UG<BPPWB hhpGPhhpEP(hhpEPmhhpEt&'jjjS.PNSV@utPEhhpGPhhpEPhhpEP(hhpEPt&jjW9j t)~PShq( pShq ]vM APSMQhOq\P9t7M APMQSj/Phqjf*>PaPhqne[^_]ÍUWVS] }>jSeyPNj3 [t:PV;?u,=t#hhpSG POv'=uwhtf=t-URP>uSP>h hpURhh hpSh jj7SVh'q\P%8t%SVh'qh<PPhqime[^_]Ðt&UWVS]uEjCPhqCPEjP#fGjjP6 =Bu8VPh'qj'h7u!Bh/0'VPh'qjA07=8|tLj-=jPjI-PhOqj9;PPhqUl jP?VPj-PhOqj8u;P謏PhqljPd$t jQWBjjEPU Rm*6&htPdPU RhrhMhpEPe[^_]Ðt&UVS]u t6h@CPu!hCP~u VPe[^]ÉUWVS]u(hghp0{ҋ{P‰UCPR4hqEP8CPEP8$j EPcj\jP4 =Bu$VPh'qj&4u BpVPh'qjG4t2VPj*PhOqj:n9P襍Phq jWBhyhpEP!e[^_]Í&UWVS]uhhp0{ҋ{Pg‰UCPRp3hqEPb7CPEPU7$jEP_bVPh'qj53t'VPh'qj7l8P裌PhqihhpVh{jP{Pǃuj{PgtxtwjPZtbG,…u{R{trR{Ph!rf/t&h6tPPM Qhr5hhpEPoe[^_]Ðt&UWVS]jEjP2 hhp0{ҋ{P‰UCPR1hqEP5CPEP5$jEP`t_uVPh'qjy2t2VPj.(PhOqj;6PՊPhq:gt jhhpEPQ uV e[^_]Ít&'UVSE PE P^ƃUREPKÃtRt.VSu jjjSD%E PE PƃjjjS$% e[^]Í&UWVS]} CPV60hqV+4CPV!4CPCPW{<%P.(j{<%PVW$[^_]Ð&UWVSu UtУ uv't'EPRhS1ShqVMQW[^_]ÍvUWVS}u Ut%EPRhSY1ShqVWj2[^_]Ðt&UUE jPRj ]Ð&UWVS} P 'C< t< t;wj*W\7dh1hpjhjjV4UV UVh5hpW$}t/EPURhST0h=hpSFP+ uVPP tP pVP6EH$@                 Wh-r.&Wh5r&WhAr&Whq%[^_]Ð&UWVSu}u{PS,Nr~$tJrPS0Ur~ tRrPS0Fu{PS0h{S0Fu{PS0jjSWhXr{[^_]ÐUWVS} u]h SVWu hSVWe[^_]ÍUWVS} 1jbURC@P@uIWCP/u8}th jCPC@P[1ۉ|Sh ÃujI&URC@Pu)WCPu}th{&ShÃu1e[^_]UM UEhPRQ]ÍvUWVSu} c~Y~ =+~-)‰Pjh &) juharj$ËFCsjxharWCPjyharURCP,jzharURCPxj 1C h S&=~)‰Pjh~) hharj$ËFCshharWCPhharURCP,hharURCPjU0C hSe[^_] UWVS]u hharj$CNjCGhharh'GhharCP‹GP$hharCPs‹GPhharVGPhharMQGP,hharMQGPjg/G hWe[^_]Í&UMU EPRQl]Ð&U=tjhh C) =tjhXh ) jhh]ÉUVSujMt&CPFP裠t4C@PFP̲tC@PFP赲tCp Sh  ÃujICPFPCt4C@PFPltC@PFPUtCp ShÃue[^]Ít&'UVSujat&CP tRFPBPYu>FPC@ @P?u$FPC@ @P腟t C@ Sh ÃujiCP tRFPBPu>FPC@ @Pu$FPC@ @Pt C@ ShÃue[^]Í&UWVS}jh eÃt]CPG P藞t-SBPBPhjrVB-VGP谰tCxSh ÃujhÃt[CPG P't-SBPBPhjrV,VGP@tCxShÃu[^_]ÉUVSujGt&CPt8FPBPIu$F PC@@ P菝t C@Sh #ÃujICPt8FPBPu$F PC@@ P/t C@ShÃue[^]ÐUWVS}1tSvWC@P{u4} tt  t&  ދu1e[^_]ÍUWVSu~)ljPjhg) h,harj}Ésj9*C V =tK v9H ƒ:ue[^_]UWVS}]E1Zj)Ã?NE B 9>UhIharBP2hJharE@PhKharE@ PUBǀ0$hMharREhOharEPFS&EhXhar@PhYharE@PthZharE@ P[UBǀ0$h\harR5Eh^harEPFK?]e[^_]ÐUjhQh\)]ÉUjjh?) =tjjh O) =tjjh/) jjh]Ít&Uhprh  hyrh ]Ít&'UWVSEEj'hruV]SWh H EhrVSWh3 E,}t5t1h%t jh%P zPhrrVe[^_]ÐUWVS}E={t=t1 jahrhHEE uvVFtE9XuCE፶'UZt @ BE@@ ‹E j|WU(BTB$zuBP&'BPEǀ@(@,<ǀDǀ@o‹EP<01EI 9tˋ@Euu@<B &@@@t D <X} }!<RUU Mș}t&M Mȋ<~U1E<H 9]tˋ@EU9Uuu <~ @tD&'<xD@<}WN0 F(e[^]Ív'USE={u)]StE@0 t&']]É'UWVS]11҃={u\{ tvuB@uȉ֙{ t%ut AJ@uSne[^_]Ít&UWVS11E={CExuQP B @ EPPU +UE쉐E@ PP)щH&'E@ I&UBP|8zt u@uCU tME@Eu)+]E@ lvUzt @uNE@tˉșًEȋUy ǂ)ˋE )PE@EuURe[^_]Í'UVSEEPWUB(9t RxUz,tNB0tGÃƃut jjR褶 t j'tjEPE@0o jTe[^]USMU tVtR|9Q}'h u:htD.v'Y 9} @@9|SQ;S|;]]Ðt&US]<uh)t5D?vxu*h萡u%hMtD'SjS]]Í'Ut(<tRPjjU 0 S]Í&UjjPn$]Ív'UjjP&R]Ðt&US]<u(SS<Px u SSB:S<P9]]Í&'USE] Ppt9XPr &{]]Ít&US]Su St&S P]]Í'UVSuEt*]vSNt'E9pu' '1e[^]Ðt&USUREP/Ãt6StScPmu S t @, &]]Ít&US]EvEPu 1"&EtSP`u͋E]] UUщЅt <u ‹@u <@ t xDt9u߉]Ít&'UUщЅt <u ‹Du <@xDt9u] USt@xt:@PDS7SP@7 jjlҝPPY]]ÍUSt@xt:@P4S\7SP6jjlrPPX]]ÍUS]u tx{,tr=ti=u`} tThhrP蒩hhrPwhhr P\$S"]]ÍUSE={uP=tG=u>={t5]vStEx,tP|"ߍ&j O]]ÉUEvEPt0EPDEPn=‹E΍&'jjEP3]Ív'UEjjPM]Í'USE] Puh7hrSLPШ]]É'UEPu@Lu{]Ít&']ÍU]Í&'U]Í&'U]Í&'UEPu @tt Љ]Ít&u1]UEPu @t u1]Ít&UWVS}uE1ۍEPtXEtPW褴uՋU9BuȻthhrPqEH0 띐t&؍e[^_]Ít&UVSEu PÃuth{V u1hhrVPѦhhrPK0CPVS蜱e[^]ÐUEPdu]ÐUE@P!]Í'UEU tRPv%]Ð&1]Ív'US]EvEPCu 1&&EtSP uɋE]]Ít&'US]EvEPu 1(&EtSP謲uɸ]]É'UVSu] EvEPu1)t&E9XutVPGuȸe[^]ÉUVSu] EvEPtEE9Xu苀tVPuhhrEPУEǀe[^]Ív'UE]UEP4u@]Ít&UWVSE} Eu5]SjtU9Buzk=KvPup}t%]StE9pux捶xe[^_]Í&'U WVSE M19vS*E1EPt4U9ZutBڍ&']Fƍv'uh{S衶C9]pPu7E]StU9BuMJމM jjPx3Ge[^_]É'UWVS}u E]vStE9xupv'e[^_]ÐUSE] PuX@P ]]Ít&UVSuE^@ EP t4E9tP@ttP@UB9FuNjF@!B@뽐e[^]Í&UEtP@]Í&]ÉUUM ]Ðt&UEU ]Ð&UEU ]Ð&UEЉ]É'US]={u5CǃjjSsjS]]Ít&US]EvEPt,tjjEP[) EPo΍v']]É'UEPuP2]Í&'UVS]={uY1ҋ9}#v@ 9tB9|苃jjSnjSe[^]Í'UEP4uPb]Í&'UUt09~!Phmtl4Ph6]ÉUWS] t*0J9~e[_]ÐUEP9]U@]ÐUE<@]Í'US]Et;vEPt(EtSPxu1']]Ít&UVSEEtuCPh{V聡 uEe[^]ÍUWVS]} j%}ƃt{,t{PC@P~PCPPutPutPVVutPWWCPPj j CPPht2e[^_]Ít&'UVSuE PP|ÃtSS=tSPu@Smu3h茏u SVht 2&Vht11e[^]Ív'UWS]E PP‰U0HPhuRܩ u5=uhu Shup1v'EPSǃtX,tTh譎uAtPSh8u$1-GPShUu1 Shru01e[_]Ív'UVSuE ]PPtP,7v'tSVhu0&'Vhu01e[^]Ív'UVSuE ]PPytSP{tVhu90PVhu01e[^]UWVSE PPÃuhv/vUUj,S$ǃtGjSUR uLSh8v/h=hrh h>hrS{F VUR'ShUvU/tEe[^_]Ít&'US]@Pu@ PE &Ex,tPP%*PS)jjpKjjSa>؋]]ÍvUS]<P؋]]Ít&US]U C8PRhtvu 1]]Í&UWVS}E EPPQÃS^V8uVhv. t&SP迥uShv-R&tFSP菥u(hhrSPAhvEPWtpEt/SP,u!UG9BuǂEtSPuUG9BuR踫냍vhhrSP艗Sh w,S8rtKSGPGSh'w,4v'WÃtSh w,t&hIwv,e[^_]Ív'UVSuE PPiE+vEPEP蛽ÃjhlwSQ u{uhow+Å;S[ËFPS tShw+yjFPS uFPPFPSIt"Shww+SFP-t&{0u{ujFP ShwFPh hrSPʕh{FPe[^]Í&US]thw*؋]]Í'UE<P]Ðt&UVSut"FPRhxs* &'FPhxR*~uj'tPFPhx*<Ph+x *PFPPPFPF Ph7x)0PPh[x) utPhox)tPhx)tPhxz)utPhx])FLutPhxC)FPPhx.)0Phx),tPhx('hy(F4Phy(Ph&y(F@P:Ph7y( P#PhKy((F

(ue[^]Ív'UE@] UVS]U sPCPPRhys u,+CP<P%jjS 1e[^]Ðt&US]U EPRhy t1t'hyf']t&l@ tU tuӉË@uE <P<PjjSG ؋]]Í&'US]U EPRhyd t 1W'}uCTǃ &CTǃ <PjjS؋]]Ít&'US]U 8"uRP vPS؋]]Ív'US]U CPRhyu 1]]Í&US]E jPhyP<Pj]]Ít&US]E jPhyPSj؋]]Í&UEP]Ít&'UVSu<t@ .''@9t P؅ue[^]ÍUS]U PRhyd uPjd蟂 t&'1]]Í&UEP]Ít&'UVSu<t@ .''@9t P؅ue[^]ÍUS]tPSYS hy#]]Ív'UEj<P|]ÍvUWVSE PPΖt=PNjU$9~)19}URC9|U(U(PhyV#Ee[^_]É'US]E PPMtP`  PPhy#؋]]Í&US]E PPtPC@SC@PKPhz"؋]]Í&UWVSEj%ƃv}Wct}PSj؋]]Í&UWVSE0ېEP_t8Et׈щH9v҉׈щN뿍&hC}&1ۋE<@EtsEP‰UtVR]CE?Exh hrEP} t{t&'E<x}}uEe[^_]Í&'US]E PhQ}tPS]]ÐUVSuE PP\ÃtCPSwt ShV}PS>&Sht}*vPhV}hE hrP|e[^]Í&'US] jjPj{ E]]Ít&'UE]ÐU WVSE 1DžƅPPe=tahPWҋhhW‹Fu'Whrh5Phr~ƅ1 ;ut$Phrh4PhrEhˋh&'=td1RP9u4Rh WH uPW ;uujjh),4PhrE[^_]ÐU WVSEjj]UE PE PÃÃ0֍N<-tu>~BURPfK~mti8tbUR@PFKލ&'u 1;&URW&8tURWHP} yuߋe[^_]ÍvUVSu M]<v<v t uwAtr9uk&ta&9 tHAtF<v9<v1 u*'<v<v t uA9uKtȍe[^]Ð&UWVSuM M]0ЍD9u(&}M&}? tJG}tH<v8<v0 u)&}<v<v t u EM9uK냍t&'u } ?}q}h9uvcvM<v<v t uM9us9ur/}M9 tIM9r<v <v uكxE} tM} Ee[^_]ÍUWVS]} u;0ЍDEjEPSXEhhPus} u]j} |:u VEPS\E 8uIhhh{-si&0ЍDEu VEPS }tu 9u~=E9v6P<v<v t uEpuH9wՋE9v@E}u!U0ЍDE}}|E@PEPS{.'0ЍDEuVEPS E9v,P<v<v t uEpuH9wՋE9Evhhh{q$t&hhEPq‹EЍe[^_]Ðt&U WVS]u E &C<v<v t tSvu20ЍDEjEPSE *&|VEPS1 ]}u$0ЍDEbt&'}} h1ZvE@PEPS E9v.vP<v<v t uEHMH9wՅ}19u}h=hh{jp\&EE9Ev!hDhh{EPl(&hKhEPEPlEEe[^_]ÐUWVSE1}t)jh͌hόPhЌU RffD|Gt3{ u!CPC PhVVU R GuӅujhU R/ &1[^_]ÐUWVSE1}t)jh͌hόPhЌU RffD|Gt3{ u!CPC PhVVU R=GuӅujhU R_ &1[^_]ÐUE PP P]Ít&UWVS}EEG=v,jh͌hMPhЌM Qhhh{uVj9}4hhMPVkhhhVk C9|̋M@tMPƒt>EPBЉEjPM QIhhEP6ihhEP#i1e[^_]Í&UWVS}EG=v3jh͌hUPhЌU Rz9}7uhhUPVjhhhVj C9|jjEP!jPU RghhEPTh1e[^_]Ð&UWVSU] Etvr tbr tNBPBPSh&]S'njEPh/ P$h!hSgjSh8 Pe[^_]ÍvUWVS] }EG=v0jh͌hUPhЌSS'jh/Sjh8S9}:uvh1hUPV}hh2hhVhh C9|̋EPhDhPh5hEPf1e[^_]Í'UWVSM uEEF=v)jh͌hGUPhЌQ\9}7}hAhUPWghBhhWg C9|̋U2\uEjjj}tcPEPUBP.AhGhEPe1e[^_] UWVSU }EG=v0jh͌hMPhЌRc~9}7uhRhMPVfhShhVf C9|jjhjEPj,PS@hVhEPd1e[^_]Ít&UWVSU }EG=v0jh͌hrMPhЌR蓽z9}7uhbhMPVehchhVe C9|̋EPhDjMAPjhfhEPd1e[^_]Ð&US] U}t0jh͌hPhЌSּS jPBP= ujhS蛼t&jPFPS~1]]Ðt&UWVSU EEE=v)jh͌hMPhЌR,EPEPjft&MAPGPquB9]~8w hhMPVUdhhhV@d C9]ˍEPEPWYǃ u1e[^_]Ít&UWVS} EEE}t=jh͌hPhЌWSXjRW7?t&jhόW#uV]SjtP uVSP u1e[^_]Ív'UVSu ]}t)jh͌hPhЌV诺s&Cjj jPiPTPCPhSujhVRt&'jSV71[^]É'UWVSU }EffD|G=v0jh͌hǍMPhЌRù'9}7uhhMPV bhhhVa C9|jEPo jjjEPjQ  hhEP5`(jSt @PGtjh{&jh{S質1]]Ív'US] UEffD|}t&jh͌hAPhЌSLj!BP譹t@jhTPhTh*t?A…uόRόtRAPAPhVEPW!hhhTEP8RjEPS詩hhEPP1]]Í'UVSu UEffD|}t%jh͌hAPhЌV+Zj!S荸t@PS)ƒt*BPB PBPh`EP V&t&'hhhTEP8QjEPV詨h hEPO1e[^]Ít&'UWVS}E1ۡffD|}t5jh͌hiPhЌM Q(&' PP(t8j&CPGPs9uSVÃu܋6uʅu"jh+M Q袧Jt&'GP ƒC t PtEj{}t{PM QS1e[^_]Í&UVSu ]ffD|/}tjh͌hyPhЌV}jPCP' tXjPCP| t5xtjh{ jh{V裦11 jh+&jh:Vse[^]Ðt&UTWVS} UffD|F}u[j茳P~lPuV̬EE]SV躬EPS谬 EPEP蠬jVWߥ1*t&'jh͌hόPhЌW趥e[^_]Í&UTVSu UffD|V}u1)v'jh͌hόPhЌVe[^]Ð&US] UffD|c}u0jBjj jP藬PkPS謤1'&jh͌hPhЌS膤]]Ív'UWVS} UffD|q}t(jh͌hόPhЌWt&GK CluόPC(PSRC8PC' .'@''hG PSTEShDGPVb1[^_]ÍvUVSu UffD|}u,j-PhN]SޫjSV譝1('jh͌hόPhЌV膝e[^]Ð&USM UffD|}t*jh͌hPhЌQ S'hBPSSEj Sgtj SUtShDx1]ÍUSM UffD|,}t*jh͌hPhЌQ`S'hBPSREj S觫tj S蕫tShD1]ÍUWSU }ffD|=}uihGPSTRhhaSEGjj jPVƒj0HPSR1)v'jh͌hRPhЌR6[_]Ðt&UWVS} ]EffD|N}t$jh͌hcPhЌWʚjjjjjCPht8ƃt~ujhyW茚`t&CPCPPPh]SGjU0HPRFP$hXhS'A1e[^_]Ít&'UWVSM UE5GffD|a}t.jh͌hPhЌQ贙'BPPPhEPFt5~ u)^t!jU0щHPRS6uhlhEP0@1e[^_]Ít&UffD|tjh$jhjh(يjhx͊ jh辊jh貊jh覊jh蚊 jhX苊jhjhsjhg jh XjhLLjhD@jhH4 jh%jhPjh jh jhjhjhډjhΉ jh迉jh賉jhT觉jh蛉 jh|茉jh耉jhtjh\h jhYjhM]É'UWVSU]}ffD|jjR#SP@,ЉƃF E1ۅWE@PKu|tE@ C 0'E@ uVPt&'F hhEPw=hhEPd= ']C E_1e[^_]ÍvUWVS} uffD|>#u 1t&VMQWMQhhjp<É;C hhVCP=MK,jEPMQ!EPMQRB0Љƃ}u9F C }u-hhP_ t ~HujUR#OPh PjU Rh Pi jURh PPjVh P= h@jhWShbw 1' ~DtVURиe[^_]Ðt&UWVSu 1ffD|]jhTVhTÃt{jURh P聗jVh Pn jEtCPh PNjURh P8 jURh PjURh P  jjhWURh .1ɍCvuȍe[^_]ÍUWVSU1ffD|rhshR1‰UUEPR6ƃt>u"hxhEP_-v'jMQM QhTÃt{jMQh P jM Qh P jEtCPh PԕjMQh P辕 jEPh P襕jjhWVhxÃ(hhEP,t'1e[^_]Ít&UWVSuEEffD|URVh0}WS2jVU RhTRà tSUjURh P͔jU Rh P跔 jEtCPh P藔jVh P脔 jURh PkjjhUREPh(hhWM+e[^_]ÍvUWVS]U1EffD|ЅuόPόtPSh6uV1jhTMQhTÃ$t{jM Qh P菓jMQh Py jEtCPh PYjEPh PC jjhWEPhhhhV(*e[^_]Í&'UVSEu ƅ=wAjpPh P’pPPw3v'P*IPSUjSh PzhS.t'>t"jVh PGhVS+9jj*h=jPh\[^]UWVSu DžffD|jURVhT&Ãt SVURURhGhWMjURh P(jVh PijEtCPh PL jURh P3jjhRWhX[^_]Ít&'U WVSu }DžffD|VURWhGhRZjWVhTÃ(t SjURh PljVh PY jEtCPh P9jWh P& jjhRRhB[^_]Ðt&U WVSu }DžffD|jWVhTÃt SVURWhGhR*jURh P\(jVh PFjEtCPh P) jWh PjURh P jjhRRhX[^_]ÍUWVSuDžffD|URVh0hW$jVU RhTÃ$t SjURh P3jU Rh P jEtCPh PjVh P jURh PэjjhRWh[^_]É'UWVSuDžffD|%jVU RhTÃt SURVh0hWjURh P$jU Rh PjEtCPh P݌ jVh PnjjURh P豌 jjhRWhD[^_]ÍUWVSuDžffD|8jVU RhTÃt SURVh0WFjURh P jU Rh PߋjEtCPh P‹ jVh P謋jURh P薋 jURh P}jj hRWh[^_]Ðt&USU] 1ɡffD|It0:t+jRh Pjj*hPjShH2%]]Í&'US]ffD|TjE u{Ph P芊jj hPjSh(t-hWh u{P}% t&'1]]Í&US]1ҡffD|^t0;t+jSh Pjj hPjSh|ƒ%]]ÐUSU1ۡffD|jtD:t?R&PhU*'EjjjjPh\Ã$hphEP\ %]]Ít&'UWVSuffD|zjVU RhTPNjURVh0hS苀$jURh P躈jU Rh P褈 jEtGPh P脈jVh Pq jURh PXjj hjSh[^_]Ðt&UWVSu 1ffD|jhTVhTSÃt{jURh PчjVh P辇 jEtCPh P螇jURh P與 jURh PojURh PY jjhWURhL~e[^_] USU]ffD|jRh Pjh{h P̆ jSh P趆jj h]jSh]]É'UWVSu DžffD|jURVhTÃt SVURURhGhW}jURh P(jVh PjEtCPh P̅ jURh P賅jjhRWh[^_]Ít&'U WVSu }DžffD|jWVhTÃt SVURWhGR?jURh P$jVh PۄjEtCPh P辄 jWh P訄jjhRRh[^_]Ív'UVSU] uffD|jRh P/jSh P jVh PjjhkjSh0e[^]Í&UWVS}111ۡffD|} M$V' W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXY YY$x|(xX{k[K @L0DH ÓPǓ̓ѓ֓tۓ~t&nt&T^t&Nt&|>t&.t&\t& t&tRWw} tM 1؍e[^_] UVSuffD|-h|V%u&hxVu%u1&hVU%ut&hV5%ut&hV%uxt&hV$uXt&hV$u8t&hV$ut&hV$ut&hVu$u t&hVU$u t&hV5$u t&hV$u xt&hV#u Xt&hV#u8t&hÓV#ut&hǓV#ut&h̓Vu#ut&hѓVU#ut&h֓V5#ut&htV#uxt&hۓV"uXt&hV"u8t&hV"ut&hV"ut&hVu"ut&hVU"ut&hV5"ut&hV"u{&hV!u[&hV!u;&h V!u &hV!u؍e[^]ÐUWVS} ]ffD|V}tjh͌hPhЌ;&CPGƋCPLƒ}3jh0hkhhؔWk'}uJCPC PVRu{C@PC PNytfjh Wk`t&'tjCPC PVR,'CP臋t@PCPC PVjjC PW=k1e[^_]ÐU$WVSEEffD|}~UBPE1v}t 9}EPjWEEPUR1^}u$hE聨Eh/@E܋X Uz(upU'pGt&'C8*u@PVwt"CPVPPEPhnڦ[ uEP]X}u*}uh覦UBPh菦G 1e[^_]ÍUWVSu] E8u&'j}}W}}W}}WPV\Uut&E8u(jh͌EPh,h4hbViv0H9uM8uRSQbt tl}W}W}W}WEPV\u:E8uE}E}1#vjh͌EPhhVuhe[^_]ÍUWVS}Uu} uӖ'FFPVRW^uf19~-vEPFPF PFPM QW;uC9փt)uFF t&^1"'FtPwFe[^_]Í'U$WVS} u>tp(DC tF>uEt"?tEPVWUReLuE1u>t`jEPEPEPEPMQYZjEPEPEPEPUR3ZEE|8E8uMP;oE܋U]܉u1>thjEPEPEPEPMQYjEPEPEPEPURYM܉G0EPEPSEE@à E8uUMM܋U EtP9v1'EtPve[^_]Ít&UWVS]} uMӖWt&';tp(DB tC;uj.M Qtǃt];tmjEPEPEPEPMQXƃUEEPEPEPEPM QMQ^ƋUEuE8ut7UEMQEPGPMQƋUE[&}tME@P8mÃ}t%EPEPS7E&'SEPEPZMt.e[^_]Ív'U WVS} ]E?ujhMQd6uόj.WwsƃtEPSWMQ}tb0ۋUt EEPMQFPMQjEUtE}EPj_EEPs MMEPj_E}u EE@EUEM EPEPP_Ãt.MQSsEPJs6&'t.}t MQ"sEtPs1e[^_]Í&'U WVS] j.S$rƃtEP}WS}W.}ujh͌ShWjb]ty0ۋUt EEPFP}WuE UtEE8u1&'EPj^ÃEPr1ۅu*M9M~UDA9MMt&'UEEPEP]Et.t SqEPqEt.EtPq1e[^_]UWVS} u}uNhFPWp tNPFPW]à t:hSFPWpS4q%jhP PW`e[^_]Ít&'UWVS]} uEv#jhP P&'hFPWQoƒ t$}uVjWSv~uӖv'}uF 8u1&'EPRFPW1Ãtu2}ujh;FPhUW_됍t&{1u}ujEPW^1Yv'V :u{1=&'hEPRW`o1ۅuEPo{؍e[^_]Í&UVSu ]Evjh[P Put&hCPVmƒ t^EPEPRCPVetCt(jEPEPZPV]EPn1jh͌CPhV^e[^]ÍUWVS}~Ut)jhjUP PU RM^vjUBPU Rmlj} 9u~7SUDPPU Rǃ9]t S,nt9uhWUBPU RmWm%e[^_]ÍvUWVSDž }UB8-ueƿuDž vƿt}ƿuDž ^&'jh}GPhƗ#t&'}t*jhؗ}PhЌU R\t&$P(P}UDP} WNSt'(uG$PlW$Pl,Pd1&',Pb1ۃ9(v1 tU tt& tg$ U}T8ulRQbiu^`}UDP$PYƃ: }UDP$P} Waƃ t$P,PbC9($Pgk,PU Rc1[^_]U@WVSu >eujhVjf t;>lujhVQf t"URVURT" E>euHPh]Sh0҉ЍD߃ @vPbSWa FPWeURWUR!ƃ9tWkje[^_]Í&UWVS} ]Cv)jhuP PWY4t&'huFPWhƒ  EPEPRWRPt!EPEPuFPW|t EUE9M4uuuF &v'puH9}ÍvDB9|EPEP7UhSuFPWhu S-i0S"ijuVWWEP i1&'EPhe[^_]Ð&US] E}t jhP PSzX>vP:t p(DA tB:u:%PhP_f1]]Í&'UU EjPRft 1]Ít&1]Ív'UffD| = \/ ?P蘰胾Njjhh P7jjhh# P7,jjh`h- P7jjhh6 P7(jjhph@ P7jjhqhH Pr7(jjhlhO PV7jjhhhV P=7(jjhpih^ P!7jjhjhf P7(jjhkho P6jjhhw P6(jjhPh P6jjh@h P6(jjhh P6jjhh Pi6(jjh@h PM6jjh"h P46(jjhh P6jjh!h P5(jjhh˘ P5jjh hԘ P5(jjh#hݘ P5jjhh P5(jjh h Py5jjh$h P`5(jjh0%h PD5jjh%h P+5(jjh(h  P5jjh&h P4(jjh0,h P4jjh)h% P4(jjh*h, P4jjh <h6 P4(jjh:h Pp4jjh=h; PW4(jjh=hE P;4jjh>hL P"4(jjh@hW P4jjhh^ P3(jjh,hf P3jjh-hn P3(jjh@.hu P3jjh/h| P3(jjh 0h Pg3jjh]h PN3(jjh_h P23jjh]h P3(jjhPh P2jjh h P2(jjh h/ P2jjh0 h P2(jjh hx P2jjh h Pz2(jjh` h P^2jjh h\ PE2(jjhPhř P)2jjh hʙ P2(jjhhҙ P1h P$p= jP6Phؙ P3ajP6Ph Pa jhh P`jh@h P` tjPh P` ~jAAP t&jhh Py`jhXh P_`]Ít&'Uh hDh虰PhD]Ív'USffD|6 E -9x/jhK@P1 E PE Ph th PE P à ؅uE P Pt %&=  8PhPvjh[E @P u8= % dtaRhh請jhE @P/ E Phwv}E P Pa2t PE PhDN= tC 8t7PE Ph&v'hh˚ojjjj]]ÐUEPVujhޚjwXj]&]ÍUWS]0PSWqTe[_]Í&&UWVS}u ^]\ueFAЃ w)1Ҋ< wXBRLF荶& :t09t :uvJv&^uFȃ~ ȈGt&+]]S]SWuX} FKe[^_]Í&&UWVSEEEEu >>:tF>u>F>st0v>:t>\u~:uFF>u>tF v&C; t<v;t;:t;.t}u-jhSxW uCPEyt&j=SP[u"j@S?[uj#S.[t )ىM0щJU}}t2}}EPSWRV t?u}t0щʃRǃt8SGP~}u}&E8EUEe[^_]Ít&&UWVS1UvjU RCP!V ub0} ЃPhNjU RGP1Q t>v&U:SZ&&ދuuI0} ЃPNjU RGPPt>&U:e[^_]ÐUSUE H@vIл 0…uȋ]]Í&U(WVSEPhTj_P |bf}t[f}tTEuVEP|P}]SPWURuEVEPRPSO(WURNe[^_]Ít&UWVS10} Ѝx]`v& tZ6&; tC;t ;:t;|u)9u#WRM Q T uv&Cڅt:ue[^_]Ðt&UWVS1} UR!W6URhRP #tׅuU RRt t uKvC; t; t;t&&; t9;\u{ t%CF+=~  ;uˀ; FFu 1')V2ÃtVWSYO؍[^_]Í6UWVS} EEEEUhNƃtW>/uN&&WVt2VSEPƃ tVVEU6hSMSƃu|1t&j+hjP a&E}WVÃt;SEP}ǃ}t]&SBVEuVSEUEuHe[^_]Ð&UWVS]E ]PEPEu }ut16&EP=t=tPU}t>8 HE|6&j)hIjO &0}֋]t0ҍ6{щM΋uFVE uM 1U:t6MAMFB:uE:@EF]tpS0Ѝxj=RSu|@t3t79uS{t6 E@EB:uM:AM;SUTuEe[^_] USUM ]:t46::u'B8u B8Au8ZuB&&B:u1]]ÐUEj#PP u]Íjj jP.u F\F>*uF] PF׃>utqE ؁عáfG~h!EBWWEPƃv1WEPu 1u &&@WEPtPV%Eu#E 8|tW1}tE(P5SVt vSPE&EP u}t<)tChț1t(<)uhț&h՛ e[^_]Ít&UWVS}M QjE1U6&:)tVM QEPnÃu1NE ‰uE ‰t&SVދM t<|uu M Qj Ee[^_]Í6&UWVSu} WEPÃu1&<v?tEut&Eu?thRt&&+t  v*ueEtWSj h6&WSjWj?PSHSSA$Wj&PSWj PS &+ukEtWSj \ t&WjVSSWjP}WjPVn(Wj PS\Bv&?u6WSjWjzPS3Wj kƃ$VSVShHP<v?uh 1؍e[^_]Ít&UWVS} U<.K<)1<$*v&<(v<+v<\WjHE8^uWj1Ev&WjE<]tz<-p<]<-ubQQU]tuWj-P6&AXMA9:96WPMCM9~&WP9vWj8]thv&@&WEPj$Eu 1EU h$h1~6&8u hEg6WjEWPWjut&PhPHP@Ã$h\&hV1c6 ~<v?uKu€u Wj;EWPbKWjREe[^_]Ðt&USM Q(tEBBZY&A (]]UME P(t @]Ív@ ]Í6&US] MA=(u A -BA9v 6IJ9wECC]]Í6UVSEu =(t-Su;u )t&)ډCSe[^]Ð&UEU t=(t8u RP]Í6&UWVSu}t} uhn}&th}]&tO] PSl?ÃPPSK; t Cō6&UWt)WU RVta6&] t4PS>Ãt3WSVE uC׍t&&WSV( uCu1e[^_]Í&&UWVS]} u>^CPF ٺvJVP(u1 ;CPe[^_]Ív&U WVSu }TWrE1$Л6&0`@@&F9EU85E8:@&_8G0Ѝx~WRS8 >&&PGP_<.v&PGP/<et&X>VMQ[F<<X؋>VMQ+F ΐM9t}&VGPWǃ?tv&0ۋM9uY? %EMVGPǃ9}t8uVMQuOM9}~c&&P6&<<h }hk1e[^_] UWVSU1ۋM Mr<ta<t<t|<t(v0UЍX]6BM8~6CE}8tovM9td}PV9tPCG}?tF&M9t4}PV9u CG}?t&hf1ۋ}M 9؍e[^_]UM(u1]ÍAQt߀9t ȉ]Í)ȉ]Ð&UE@ ]ÐU@ ]ÐUVS]u j&2BZr =,u,&0P0Ѝe[^]Í&UE=H u D ]Í&US]E =D tgD H u1v,t66:uRut$PSB PBЃ ΍&&H ]] UM,9u!A,u90-6&9Jt R9JuAB9 0u0Q^8]Í6UD ]ÐUWVShh0Í CCjC PjC@PjCtPǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃǃ1vDŽDŽ DŽ @~j4Pǃhfflnǃxǃ|ǃǃǃǃǃǃƃP =P tVEPPC PC<Љǃ }t3j.‰:FBBB BBW >uSػSbVS|}jhhS5jhhS5,jh jajhS?:hhϞS$jYt PS]jYt PS]jYtPS]؍e[^_]Ít&&UWVSuj-á PhӞ}W3 uj4s-jP |RWP@0ЋM MKX p[^_]Ít&&U WVSE} utFEPRÃt3C 98u9puP4SEPÃu΍e[^_]Ít&UWVS]u }uj4,jP URVP@0ЉÃ }uC jQ,8MHC e[^_]Ít&UWVS}U t/RP@,Љƃt^ t WCP҃S3V e[^_]ÐUSEU ]t RP@,Ѕu1v&P tB]]Ít&&UWVSuu~ hu hL hJ^ SF8Ѓt PTEPS2v&~4u @t&PMQEPF Pu̍F Ps]SF@P tv@ Pk2SuF@P:toMM싾dž.X Pt MQCP҃S2MQW>uWW1uFtPVJMQt=thuMP1&&MP҃MAMtPj1džtPM1džt?19~P1C9勆P1džt.vX@ P0P0uՋtP0dž1ۍ6t'P0 P0DŽ C~VPtX PM0u L y L V(0e[^_]ÍUE]Í&UUu h0R} ]Í6&UWVS]]U :tuu JuE RUt1t&&EPU RE PUB<Љƃ }uFUz4uFFPSEPU RE PUB<Љƃ}u F P/ji'É^ 3USUSUS USCU :bu1u RuEPhJE PUB<ЉƉ^ ؍e[^_]ÍvUSUE ]PB PB8Ѕt%P BCBCB C Bt&1]]Í&USUE ]PB PB8Ѕt%P BBCB CBC t&1]]Í&UUE tu Z]Ít&z4u @]Ív]Í6&UUE PR]ÍUWVSUUU :tuu JuE RU RU URUB8Ѓu&X {tPp&CK t CPуU :bu5u Ru!hJURUB8Ѓt P?t P0S,1e[^_]Ít&&US]E PSPS]]ÐUHWVSDž uDžZ|VtCthuP,t&&P҃FƜ1ƁDž8$u,Dž00Dž4M ǁƅtƅ]rB9}t[g6DžǟMQGjhӟPh՟MQDžp&8U$€ht ;t uڍv&9#uu<\u(PV vΉ&< >u6^&&$(1)$PSPPQVQV B9$t/9}6+$9|鋍$9P>!1҃9}vB9|9tV(  tNP SF8Љu@h˟SF8Љ|DJy˟GI tp9|YQWFPFPQPMQBPBЋ R u|Qtdthu<P'76&P҃AƆVWMQFPFЉ4tQuV-u89|u"tQuV8$9t R&9tQ%HuV^u|MQuO&u16&Qh3P# DžA.F} 9t+? u AG9uv? u FGӡp(DP u;tۋ+=~DžQuVQPhVt&VQPht8P("8PuV=[&&uVWjhhhŸV,&[^_]Í&&UWVS] u}j‰rzMB Ѝe[^_]Í6USU] 9u,C S%#0t&&B A R #6t6Q 9tхu]]Ít&UVS]u u>jPjhS" ujhjhS"jVjhSn"e[^]Ðt&UWVSu },SvFtjPS t&,PWÍ,PU؍ [^_]ÍUVS]E ǃPSne[^] UMU ~]ÍvUE]ÐUVSuVÃu Vh؍e[^]ÍvUWVSu}VÃuhx(cWU RVhȠ؍e[^_] UVSEu VPÃu Vh؍e[^] UWVSEu }VPbÃuhx(WURVhG؍e[^_]Ít&&UEPl ]UEP\ 1]Í&&U]Í6&U1]Í&U]ÐUWVSE}jh/UPhBvURU20}ЍXcuKSh\R u8}t"jhcUPhl~t&&[f;f7ShUBP E]vjhUPhסEPUBPU R U U]]6U8-uƿuUPƿuEPPU R t&jhPhq&&EE}w}UREPEPU R<8&sShUBP] EEvjh UPhסU UE]U8-uƿSuUPƿuEPPU R t&mjhYPhQ&&EE}w}9}t+EPURU R* t &&cE}t<t&&EPcEPQEPUBP=}&jhrUBPht&&EPt&&ShUBP uG}t!jhUPhl@& cPhU P"1'jhUBPhעU R e[^_]Ðt&UWVS} t(p(DB t CDB u;+uCEjjPSEE9tl=t("u#Mjhh hQ3W8t(p(UDC t ruzuE8uuM11"&jhrWhMQ e[^_]Ít&&UWVS}tE P vE P1ۋE8t8%u(&&C@8u፵,VSVvWURS,PtVUR1* Vjh>UR  [^_]ÐUU E}u]Ð&jhPPhRR ]Í6UWVS]U)jhlPhR} W -&z}ErDžxx1t FO)EuE+EE}UDž|u+EPEPP} WƃDž|EH9EVE} 9t$p(6DC u \tA9u9udE}4>duu}G}E}P}W{~}G}t&}G}T&EPEPE}P} Wƃ19u~EP}WuC9]EP"9]EE9E}t\E}P} WyƃuAGPE}DPhţ]SS} Wv} 1|t EPl[^_]Í&UWVS] }uGv&jhPhRScv&FPSEu+jPFPSujhSSJ URhP1e[^_]Í&UVS] UM~jh PhRSb@*uA,VPS tPSJVt&&$[^] US] U~EPBPC1]] UU E}u]Ð&jhPPhRR]Í6UWVS] u}]Fv#jh,PhRSN[~G8tPS|u jG PjhNS*UjGPSe[^_]Í6U~u=PWVM Q8ƃQSVjW ~'SPBPSM Q XtP.u&j=|u  jPM Q  [&&tShMAP9 }tMA &MqQWV uH>~uCPSVM Qƃ%QWVwjS/~:PujDPM Q :&rShMAP uzvu}tMA MAP4ƃujMAP&jMAPM QI H eugShƤMAP} uNvI}tMAƤ t&MAPƃjV pShФMAP uj}tMAФt&MAPTtr t%ijh٤t&jhot&jh_t&sShMAPy uzvu}tMAPPMAP1ۃ 9~ PM QeC9ዅP t&juGShMAP u.SEPEPSM QK6PMAPM Qƃ uDžrugShMAP] uNvI}tMAt&DžQVa &wuGShMAP u.}tMA6&Dž뎍t&eShMAP u*v%}tMA0Dž;euGSh&MAPM u.v)}tMA&t&DžaugSh-MAP uN}tMA-6&EPVj EPh3v&iSh7MAP u*v%}tMA7 ViuGShCMAP= u.v)}tMACt&luwShJMAP u^}tjhPl]SVj jM Q-PheMAPhivmugShzMAPm uN}tMAz 6&EPVj  EPh3[v&ouGShMAP u.}tMA6&16&rShMAP uzvu}tMA@hSV6 u&jM QPheMAPhEƄ(jSM Q t&sSShMAP  uZvU}tMAEPVj EPhM Pl UsShMAP }t7jhMPhRM QDžv&]SVj  ueu!)uCZv&U40uiC9]cjh5U R\jhѨUDPhܨU Rc,1UPU Re[^_]ÍU(WVSu ]}Cv&jhgPh}VhGPVƒ EPRVi thVut&u E,EPGPV2 t hũǍt&MM܋EPhީ]ShSGPV8t1&&e[^_]ÐUWVSM M}+jhMPh}M QMt&&MQ20ЍXaShR' }t.jhMPh}M Q &&MAPM Qpu)jh MAPh!M Q= &X CPM Qu6&bu{Sh#MAPa ub}t,jh(MPh}M Q MAPMQ<@Mx v&cSh8MAP uNvI}t#jhAMPh}M Q8 vM싁|PhީcWShLMAPm }~+jhUMPh}M Q t&&EPE P ƒvMy4uZ6Z}uMAPSzt SM QEPƒu6 cu{ShjMAP ubv]}t'jhsMPh}M QI &MAPAtM &M &dShMAP }t$jhMPh}M Qi t&MAPMQ`X 6 CPMA P}CtFjPMAPMQKjh!MAPhڪM Q9 &jhMAPMQt&Y6&eShMAP }t$jh MPh}M QI t&jMAPMQ uzj(MAPtM1i 6M싑u#MAPEtPM싁v&MAPRB,Ѕt@ @t@@tM뙍6gShMAP }~$jh&MPh}M QYt&EPEtPƒ*vB @uAM샹u Z Z}uMAPS t SM QEPƒu hukSh:MAP! uR}~,jhCMPh}M Qj2PM Q_Qv&l'ShNMAP  }u+M싁@4PhީMP}EPMAPM Q )U6M싁u#jh!MAPhTM Q6P4UM싑tʋE69B4tRDutB &&pGSh MAP u>v9}t#jhMPh}M Qhvhh$+pSh3MAP }~+jh9MPh}M Q]t&&EPE P`ƒvMy4uZ6ZB Pt'}uMAPSt SM QIEP-ƒuf sShKMAP u^vY}t#jhRMPh}M QuvM싁jPM Q&&su[Sh[MAPA uBv=}t'jhnMPh}M Q&M y6tu{ShMAP ub}t,jhMPh}M QAhhM QwM t&&vShMAP] }~$jhMPh}M Qt&M싱u΃tEPVƒ~vB @u5~(uZZ}uMAPSjt SM Q EPƒu& jh!MA PhAPhΪM Q[6&wuShMAPQ jhǬhh$h`htMAPhM Qe[^_] UWVS} EUu 56t+jhPh}WFrEPEPBPWtQ&19]~2ujEPW jEPVWC9]ϋEP1e[^_]Í6UWVS] u}t+jhŭPh}SV:eu80HPhҭR uE61EPFPS t }VvEPEPEPEPRS9utE8uu‹EHMHyȋEtQ=~@P;C}t! UEPRQEPEPEP1e[^_]Ít&UWVS}1jh֭MPh}M Q&MQ:eu50HPhҭR` uE8&EPMAPM Ql tt&&EMAE1ۋAE9]~4vU:t1jEPEPEPRM QC9]ϋE8ujMAPM Q5WvEuM9At+t%%p(DB uFt %DB tjMAPM Q 9]~vMPM Q|C9]E8tjPhM Q1e[^_]Í&&US] U~EPBPC1]] UVSu E}tjhPh}VN1ۋ@E8t1vjjEPEPEPVJu!E8t CE8uShީP1e[^]Í6&UWVSu}tjhPh}v&V:eu80HPhҭR uEE4t&EEPFPM Qؽ t&}}EV :eu;0HPhҭRV uE^&&EPF PM Q_ t8M Q/jh!F PhM QE9E~(}u"&]St&&1ۋ~9]~>6jjEPEPWM Q~E8u }u C9]ċ]}9]|,U:t#jjEPEPRM Q.u`C9]}ՋE9tQ@p(DB t'ӍvUB9tz\tE9t BDC uދEjWM Q~E1e[^_]Í&U WVS}!jh6}Ph}v&}W:eu50HPhҭRp uEEAEEP}GP} Wu tWHjh^}Gw6&}W :eu50HPhҭR uEX&EP}G P} W t5Wjh^}G Phz} W#|6&}}EE}GE1ۋw9]~?>t>jEPEPEPV} W+#E8u}uC9]€>u%j}GPh} Wt&u9]|/U:t'jjEPEPR} W躾C9]}ы}W9t1F p(DA t 6F9t~\t9t FDA uj}GP} W 9]~}P} WC9]U:t(} 8u jRW6jRh} W1e[^_]ÍvU WVSE}Uru EUrtwruEX&jhUBPhޮ#t&&}t*jhUPh}M QIt&EPEPUMDPU RDt=vEP&6&19]1}tX}t t&&}tZ~&MUDPEP%Pv&MUDPEP*t&MUDPEPM Q% 2C9]HVhީU PEP1e[^_]Í6UWVSE}*jhhUPh}M Q:= tU Xt&M 4 EEH9E]vU0}Ѝxw.jhyhPhïU RF6Mqau$WhЯQ u46cuKWhׯP u6E9EW4UMTUEt&du+WhPe u &iu[v&WhP0 u at&iu+v&Wh+P u41t&rWh4P 4EEH9Ee=4uh8jMQh8EPEPUMDPU R菼tH6&jhhM Qs hjEPEP=u%U REPEPM A =4u h8EPt e[^_]ÍvUVSEU 21ۃ=t14uVQx6&u[EPQ Pk uEPV PT t h:bUE99ZPEPQ P7 uEPV P t)hp Py1&EEEuػE6&<Qh8?Vh848P PcSh8 =th Pǰ1`v EjjPR3à E9t8t$Rjhʰ P, = uۉ؍e[^]ÐUS] E}uS*t1jhPhS]] UWVSEDžDžDž}=jhh'PhM Q` MX 6 :-}ֿW u DžJֿ`t-ֿhtjhkRh&Dž M}r}XQ)j PQBX>t!6:p(Dxt *B:u፝,Sj APS,?t>vp(DXt *B:u6& 1yV] StWWQS_t,PXPuF] &jh DPh] S t&&E19u3P PVQ uXt/jh DPM Q jh DPM QutG)HP)Ph$SjS DP] S0 [t&&) Iʋ)ȉjR DP] S F9uM ñ1[^_]ÍUWVSU]Dž@Dž<%jhűPh,JvK,JC8-6,1`uDž@&&,1uDž<Y6&,1hQjh,PhM Q製6&,J,8-/@XSj,PS$X009t260p(DPt *009uЍ,Sj,APS,409tQ0p(DPt *009u&&,1I4VM Qu8u&&Dž(Dž$409v4Q0Q8QM Q|$PPTPj8QT+4,qƊ(Q0+4,APA PM QqDž( u.jh,A PhM QO6,Q֊Jv&u1 \^< w ÍxTt&\t &FjR,A PM Q\^GVF9t(jR,A PM QqHPLPW8QyLtWHtM+4,Y+4Ê jR,A PM Q >\uFVF9t!jR,A PM QNP90un0+4,AFffF(QFP,A PM QTPA0v&0<t0909u $u5(Q0+4,APA PM Qk$QhM P1ۃ @t,PXP ؍[^_]Í&UWVSU U}tjhUPhUUB8u5BPURؚjh'UBPh@U6URUPE PUB8ЉÃtjhOUBPhiUvU:tuu{uEURU:tuu{uE샲URU URUB8ЉÃu5jh'UBPhU RI S UBPBPURU RRt vS誩UURURURUB<ЉËUS U:bu4u쿃u URh{URUB<ЉËUS U:bu.u𿃲uh{E PUB8P1e[^_]Ð&UWVSU UtPiUǂUtPFUǂEEM}(]U2F3ou,uE eu+3uEru+3uEibu+3uE9cu+3 uE EPPU Rp U R<jhhײPhU R菴t&U2 u*0;PUh&U2 t*jh)PhTU Rut&&0;P肼UPQ莺 EE}}ujUPU R跲EUe[^_]ÍU8WVSDžDž}*jhaUPhU R?t&DžDž0UzЍE&&PrUZ;R6F;%C<%u%Fv&<*u *FC1Dž ѡp(DPtFC ѡp(DPu* $`&P &dBt&&uBt&&s0UzыJ&#cB&&FlfFfBvs0UzыJCF;]u7&PhU PdDž{&B$BC;WE9zU Dž#6U Dž &U Dž&U ѳDž&R1Dž9~RPC 9&BC ~EPEPEPEPEPEPEPEPEPEPEPxPlP`PTPHPu5fUfUUZ;t|u6EVW`C;u`t&UJˀ9t?vU8t*U8uQW#UK @8uC;uċU9ZtQW1e[^_]Í6&UWVS]EE.jhsEPhu V &&EP2h0ɉ׈щOcWhR t)jhu6VhE Pn 6&uv VE@P…~u ñA 6&}E & &&u  6hfWhE@PYƒ t/jhu6VhE P贩 Eu~h0ɈщO^ ;t<9hu+WSuvVUȴ UԅuڋE+P }uC;uR" v&hiWhʹE@Pyƒ t/jhӴu6VhE PԨ uVE@ Pu V\…UEX0ɉ߈щN9~E u 6Ff&&hlWhE@P詳ƒ uHvCt.jhu6VhE P4&&EKt&hluwWhuvV=ƒ u\vWt"jhEPhu V藧60ҋExщNVhE Pk&hmWhuvV蹲ƒ uht#jh%EPhu VIvE@Puv V …tE ñ6&u 6hrWh<E@P)ƒ dt/jhBu6VhE P脦 u~0ӍshEPuv VE Pƒ huV:eu70щNVh\R肱ƒ u]Y6&EPuvVE P茔ƒ t3u VZjhE@Ph`V豥}}Eh9u|NuU9UEXӊCECjuvuVE PaE܈CNht3WhuvV虰ƒ {t&jhEPhu VjE@Pu Vޣ:v p(DHt *B:uhtWhE@Pƒ {t&jhu6VhE P;ljuvVE P.u : p(DHt )B:uhtWhE@P9ƒ 4+EEuuv uD&t+jhE@Phѵu6VhE Pt&Eػu^}t=ht0Mt&&tA9huC3hujSE P}u 0ɉ׈щMЍt KzFh9t*6MvtA9huK3h9uC&htuwWhӵE@Pݭƒ uvEuFӵhtu7WhܵE@P蝭ƒ uvEuFܵdhwWhE@PYƒ t&jhuvVhѵEPhvEXuV@ Pu V9ƒ 0ҋExщO}}EU9|6& p(64hDq u_uB9|9UuBRhE P hwWhuvVYƒ t6jhE@Phѵu6VhE P u^EPv VE P)ƒ 0ҋu~ҍr9u|UU14&ыp(hDB u_uIy9MtAQhu 6V 1/t&jhhhRE@PhTu Vʟ\[^_]Ð&UWVSuM DžDžDžF96M :-0Ѝxw7jhh PhM Qzbu*WhŶRf uDžlt&& xcu$WhԶP0 uDž6t& xvYWhP BDžCF9F9tLjhMPhM QA&,P蔦v&,V贤M ǃ? [$|g&\W:9t )PWS| (P P'j'PSQ ( ǃt&9t )PWS P PM Q] jPS 6&tw9t )PWS蹣 ǁ @PM Quy@ jPSiM Q!t&&@ & 8c 9t)PW,P ,PM QΤ1[^_] UWVSEHE]]EU8-ƿ$uEqv&ƿ+u EKt&ƿ1t-ƿhtjjh9PhT?t&&EEHEERE>jhd]Ph] S\6&MU뿐t&U]HEZ]EEPEPBP] SIƃt`t&&] &jhE]Ph·] SQt&EEq&B9EtEE]4>duB9u}tQ}tt&}tZ}&E]P]SEE%EM&E]P]S荗E*t&E]P]S] SɟE }UBuMv98-uxu6&EP] S|ƃuHCPE]Ph]SS] S t&&EU9U1}t EPרt[^_]UWVSu}jhsPhM QfV M0ЍX}au~ShR誣 u+v&FPEHPM QMQt&&}au:ShFPc u$vFPEHPM QMQ ot&}bu:ShFP# u$FPEHPM QMQ莍46&}c6Sh FPߢ u vFPEHPM QMQ腍}cShFP蟢 u vFPEHPM QMQŏ}cShFP_ u vFPEHPM QMQk}cuzShFP# u$vFPEHPM QMQ艐/t&}cu:ShFP u$vFPEHPM QMQ艐t&}eShFP蟡 u vFPEHPM QMQ腐}eSh"FP_ u vFPEHPM QMQk}euzSh'FP# u$vFPEHPM QMQY/t&}eu:Sh,FP u$vFPEHPM QMQ詑t&}fSh1FP蟠 u vFPEHPM QMQu}fSh;FP_ u uFPEHPM QMQk}fuzSh?FP# u$vFPEHPM QMQ٢/t&}fu:ShGFP u$vFPEHPM QMQ t&}gu:ShNFP裟 u$vFPEHPM QMQ) t&}hu:ShUFPc u$FPEHPM QMQ讐t 6&}iSh]FP u uFPEHPM QMQ+ }iSh`FPߞ u vFPEHPM QMQ% }iuzSheFP裞 u$vFPEHPM QMQ t&}iu:ShjFPc u$vFPEHPM QMQo t&}ju:ShqFP# u$FPEHPM QMQ4 6&}lvShvFPߝ u vFPEHPM QMQժ }l6Sh~FP蟝 u vFPEHPM QMQU }lShFP_ u vFPEHPM QMQuk }lShFP u vFPEHPM QMQ+ }lvShFPߜ u vFPEHPM QMQ }l6ShFP蟜 u vFPEHPM QMQe6 }lShFP_ u vFPEHPM QMQk }lShFP u vFPEHPM QMQ5+ }luzShFP u$vFPEHPM QMQ t&}lu:ShFP裛 u$vFPEHPM QMQ t&}puzShFPc u$vFPEHPM QMQUo t&}pu:ShŸFP# u$vFPEHPM QMQy/ t&}rShʸFPߚ u vFPEHPM QMQ}rShѸFP蟚 u vFPEHPM QMQU}ruzShظFPc u$vFPEHPM QMQIot&}ru:ShFP# u$vFPEHPM QMQ9/t&}svSh߸FPߙ u vFPEHPM QMQ}s6ShFP蟙 u vFPEHPM QMQ}sShFP_ u vFPEHPM QMQk}sShFP u vFPEHPM QMQe+}suzShFP u$vFPEHPM QMQt&}su:ShFP裘 u$vFPEHPM QMQ t&}tu:ShFPc u$FPEHPM QMQt6&}uShFP u vFPEHPM QMQ+}uuzShFP u$vFPEHPM QMQٰt&}uu:ShFP裗 u$vFPEHPM QMQ zt&}wu:ShFPc u$FPEHPM QMQ t6&}au:Sh"FP# u$vFPEHPM QMQ3/t&}cu[Sh(FP u$vFPEHPM QMQ蹄t&}cuSh+FP裖 uw!}eu9Sh1FP肖 u#vFPEHPM QMQv}fSh5FP? u vFPEHPM QMQU K}fSh>FP u vFPEHPM QMQ }fuzShIFPÕ u$vFPEHPM QMQit&}fu:ShNFP胕 u$vFPEHPM QMQyt&}guzShTFPC u$vFPEHPM QMQ Ot&}gu:ShYFP u$uFPEHPM QMQymt&}ou:Sh^FPÔ u$FPEHPM QMQ~ 6&}pShcFP u vFPEHPM QMQ蕾}puzShgFPC u$vFPEHPM QMQOt&}pu:ShlFP u$vFPEHPM QMQit&}ru:ShpFPÓ u$vFPEHPM QMQyt&}suzShuFP胓 u$vFPEHPM QMQt&}su:ShzFPC u$vFPEHPM QMQOt&}tuzShFP u$vFPEHPM QMQt&}tu:ShFPÒ u$vFPEHPM QMQt&}uu:ShFP胒 u$FPEHPM QMQ>66&}vu:ShFPC u$vFPEHPM QMQ5R&jhhhhhRhhhh2hiFPhTM QZe[^_]Ít&&U\WVSEuEfu+EPMAPM Qt t@jhMPhM QՅt&&EP7u~R}6MAPM QXiÃt/uM APhW蠓WM Qr&NEPM+M)ʉ)ЍU+UP$]M Q譇E~EP4$ &$hλM P1e[^_]ÍUWVS}!jhMPhv&MQr0ЍXa ShR }t$jh(MPh@&1MQ :t4vEd}}ig~y=}K} xOG49u7d]hDHh9&}}=}} =u}9= tv8u}9xu| 9t }X} 1t&h},tt{hnh 9I‹w4<E9st&=)t&xMTul)MQd)Ƌ@E=<4}94Up )lj}Wd)Ƌ@E=<4}9t 4U}=t5p}=x%$p[v&\ \0\@\P\)W`\\\\\@]P]p]]]]]]^0^P^p^^^)W^^_ _ _0_@_@_`_p_``&0t&4t&$t&(t&,t&A@DLZ6A@ADL0ۋ׈щMQd‰VEPRcjh }WkE$uFEU׈щMQd‰VEPRbjh}WjEuEU׈щMQcd‰V EPRtbFjh}WU8Ãu*j-dCShqhWU7;u3Sho@t&&CpsEP]e[^_]Ít&UWVSUU:UUj@Ph RjjU@ PhURjE(U@E EPjVËURAIURBSURHSEjEjώÃU20?u,jU@PS軛jhoS讛r6&jhqS蓛jhS膛jU@PSu$jhoSejhSXjUPSJ$jhoS: S衝0uUt6U9u[uURsBU@PiU@PiU@ PiUXPiU UBe[^_]Ít&UVSu>t3vCCP8iCP/iC P&iS i>uViVhoe[^]ÍUVS]u j Fa‰rBe[^]US]E 1ɋt369u$9Buu BBARh 6ыRuϋ]]UVSuCCPSRhuVg&UHWVSu}jhEPhj&uPj]`ƋE FVh0xhP3E0ruEuEPEPE P9 EX0щOp(DPEPSE PEƒ t }}E}uEPD j_É3}u%Vo!ǃt( p(DA t 6BDA u<-uBEjjPRWt&<+uBEjjPRWE8=t("WPjhhhWP6t(EjPVU [E9t=8u8=t(tWYPCSPRW ^t&ǃLt&ǃS 9t70HSS+S )Ѕ~ PC PCЃVC PT1e[^_]ÍUWVS}u ^p(DB t 6CDB uuF^1hv&<+<-Stst(EjjPSUM=t("u*jhhhW}OvFEFMǁ`t(EjPSrS MQE9tJ=t(t!$Wut&&FFMǁ6؍KN]$`~ppP`pppppppppppppPЁpppppppppppppppppppppppppppPpp pppppppppppppppppppppppppppp0p`&FFPSW à ut&&WLtMǁMQSFLJCPW-VBVt$Mǁ' MQPW WK\&FE PFPjj"FPW *t&&FE PFPFPWDgWKMQA PWNFt&Ft&Ft&Ft&F t&F t&F st&F ct&FSt&FCt&C<u5^Fv^F&&Ft&{=^Fst&{=u^FW&FCt&{&u^F'&Ft&Ft&{|u^F&Ft&Ft&p(DPuC^F^MQVWbe[^_]Ð&UWVSuM@1dTPMXDž\0Dž`VM QMQà : M AuAVjQMQà M yjhPh( u M AM y uAM ABVPQMQ à M@t{t4/ t{ &u u*F^&&O v&u>t&uFD@u t&u26 u$DPM QMQà Q vM yPTGv&t GE 1 &&9U}ߍGv u(FD@dž!vu@u>t uS>tN@DPPM QMQ@v>~F FVHPM QMQsÃM yPT@DPHPM QMQ&@b6@DPHPM QMQË@nM yF FVHPQMQvDPP DPRM QMQkÃM QtBv @{GO$&   @@@@@@   Etut&&!E6u}DP 6EuVMQy6&uugۅDݝHER6uKuG^dž6}u&M[6G$&``0P@uD&F܍H^o Du9 &؋M!jh!h0hQ>B6&<1ۅ} <C<}@:}u'݅HD@DE1>u Dt&M8dP9tRKt&jhM Ph^MQ:빍t&&jh4Ph{uPhMQY:j0[^_]ÍvUVSu] C+C )‰Ѕ~ PC PCЃuPhC PH&uC PCSPRVYDǃe[^]ÍU WVS}UuD =t.CPCPFPPPUR$$>u׋U UUG GG WG0GWjEPUR}t)jhU Rh^UR8k6&uWGD@u(EtEu't&؋GPGPUR1e[^_]Ít&UWVSuU }DPRVà uOEu D>vu+݅Hٽ@@ <٭<٭@ dP9tRH؍0[^_]UWVSuU }DPRVà u?Eu ۅD.vuHLW&dP9tRG؍8[^_]UWVS}U uDPRWmà uWEu Du+݅HD@ &VPPWb'à dP9tRF؍8[^_]Ð&UVS]U DPRSƃ EuDPhPqDp&u+PLHPRS@K dP9t CP jPS4 dP9tRE<[^]UWVSMU ]}EPRA@PApЉE }t j >uF uN ~19} DB9|uquqe[^_]Ív&U|WVSUUU Z&C ѡp(DP u_tU ZURU RUR U zUVE@PUBlЃu+jhVhUR4Ut&&U@ E8u0URU RUR tU zg61]1vUB BRjU RURMMJUuDU|uU\UDU|uvUB}U Um$XmDP$UB}U Um$XmP$E@t-UEs&UBDBD UH9u/U BtdUy(&U Bt%U&&Gpt&Ut$Uǂx EPEPURUBPB }uUǂE#v&UǂEBEBU B196&U t&jhU Ph^UR1x[^_]ÍvUVSuE t(!t E@tjhh6"t!EtEuJD@ujhhY&)jh)hU=Rh^]S?jShahjV0 jPhxhV3e[^]Ít&&UWVSU} E]t(H pQVS=t(u1 $We[^_]Ðt&UWVSu} M]t(9uAQPRA QPR&AQPRA$[=t(u1v&C SPRWe[^_]ÍvUM EU8u)@EuZQ&&@}3؉By/jhhhQ/2]ÍB1]Í&USM]9uAQ CS &A[1]]ÐUS] UM:uBAv&BEuBEuEjhhhSf1: EtB}E EmYm1]]Í&&UM EU8u@Bt&&@EuRu3jhhhQ0]Ít&&"È@r}E EmZm1]Ív&UU p(DA t 6BDA u<+t<-uB p(DAu1]ÍBDAu<.t~u9utjhqU R. WVU R .jhtU R-CuU e[^_]UWVSjU RURà 9]tjhtU R- 6&;\t Ct~u9utjhqU Rn- WVU R`-jhtU RP-CuU e[^_]Í&UWVS1=xu4hx=pujhUp1ۋMQQxP xxt/jhuM Q,xHP+@PMQ&xt 1Axt.&&x(t 1 x0t  xtP)VRM Q',jhuM Q,x\P"6&j:MQ4]Cj:Sl4Ã)u.;:uݐjhwM Q+C ;:t뿍t&&~tj/WRU4UuNVWM Qd+jhtM QT+Cm6&Gu 9}<~ttj/_S3ujWM Q+jhtM Q*v߀;t ;/tC;u)~{u?.u jhu6u+?.u&.u jhwM Q* At&&?~ujhuM Q{* VWM Qm*jhtM Q]*C_M e[^_]UWVS,P)}(|rv&Dž$E9$gv$E 4/u1(WEP*jh}W)>/uKF>/tB~u(P}W*((E9xt.u~/u ~~u>EP9(t&8|/tjhP)B 0ɉ߈щD P}W*у>t-V/u:/uBF:/t:t /vABF>u։ʋE+RP)$}9$ t&&}E (WEP?WCƋEP 97uL9(t&>.u!N/t\u~~u'6&>~u(P}W)(>9(t&E\/t:tjh}W' EP0ɉ߈щD P}W(у>tAV/t\u(BF/t\t:t/ &ABF>u‰ʋE+RPH(}E <9t&Dž Dž$E9$]j,S'S$E :u+~u%(}9GtFat&Dž Qt&^>:u u+F( tjhu}W% :% 0ӍSRVEP% ހ>U$}9$,P&}[^_]Í6UWVSu]U :~$P(PR =|u$0D,W$W$@PVh‹$$8u WJ&$P.1nv&Sj$S$P(PFW&$P-6S:$SE Pj=|u8t68/u\@8u[^_] UWVS}1|tr tDg6j/.j:W,uj/&j:W@'ƃ&;tPhzB,tC;uj.W 'Åt t9v1ۉ؍e[^_]Í&UWVSu] };uIh~菳Eu%t\VjhhVIB&WEPj26WSeu"tVjhShV1e[^_]Ít&UWVSDžDž$Dž U9 }qv U8-uRƿ t$ƿtajhPh:6Dž$ U9 |M9 |:jh UPh(M Q/~t& Ð&,S!1 (Mv|tr.u.z'j:P.*uujR"8~ƍv<\uF &PW)uF>uՊhB@Ph*uR@PM Q ,$u!U RjhJhbM Q1u$u]Dž9,tjPR  t&VQWU Rt$M Q (U9(zM 8$tj~u{PhU R (U9}2j(UPSM Q(U9(|jhM QDž ,P![^_]Ív&UWVSu} 11ɋ:tXt1Iu8u@&<{u A &<}u I6&<\uB:u1e[^_]ÍvUWVSuDž ƅMI~MD1ۉ>tI6>\u'FPM Q!'tF# PM Q&tCF>u|te&M 9/u8utt:gjhuOt&u,E:8jhu :uKKvjhuMQ K6&9:u%jhuMQe t&>~PM Q%twjhMQ u[둍vM6>tA~PM QY%t u~jhMQ Dž11ۉu>t 1t&U<\u'BPM Q$o&PM Q$ugU<{uC׍OMhEPMQM<}8EHMxE(S)PVS,$MI}9ދ]KMChEPQMQ|$QVoE)PSV2$j@PV(PMQM QMQ u9Mw}(Pf t&&EhV#t&EEPVMQM QMQ]EEE)PVMQkE 8t PMQM QMQ^6&|t`6j:MP"ujhuMQ M jQ!yxj:CST"^S_t&&MyuG\u AouFvAWh]S u SvWhS u 5t&}tjhM QhMQ! v&1e[^_]ÐUEU H@@@@ @@@ @ @$P(u@,@0 ]Ív&u@,@0@]Í6&@,@0p]Í&&UVSuV9u96&*v&Åu h9t名t&FHV,e[^]Ít&&UWVS}19w~#tvP؃uF9wݍG9tRG,G0e[^_]ÍUUE @@P]Í&USMyu$Q9S1t&AAytߋQAЋ]]Í&&U}}~EPV~JfF ~$ F$}}}x}F(u"CP#V$E u iCmNA61ҍK~ vHimNAN #V$CC}uME}F9Et }Wje[^_]ÐUVSuusdžh 1ۃ9~8j(y ‹؋D(C9dždže[^]ÍvUWVSu MMu QO}W p(DB t FDB u>uMQ1}H@9 LJ}ME0ЍX| u K| tCPMQ SV}PB1MuN}LJE% tVMQ&V}WMǁe[^_] UU+UJ)ЉRhMQ0 jEPMQE PE؈vj VXƒt'BjhVM QUUĈփɐjVE P EGM9MEkShEPR ƒ }t"jhMRhE P7#6URMQRE Pƒ ]Sv!jhMQRhE PRkEЋUM9}J)y&&EF19]~e}ЋM9|19})E LO!t&j(‰ED(CF9]1 Eڅt RB CM9ۋER$ EЋM]䋑9}Kv&JMUEt&nukShMQRƒ uP}t*jhERhM Q_Kv&EBRhR` \vrShMQRƒ u|}~&jhERhM Qj}tEPRMQ%ƃREPRM Q`6&sShEPRƒ u|Uv!jhMRhE PF2j}tMQREPƃ MQ RQRREPv&wShMQRMƒ Uv-jh ERhM Q&j}tEP RMQƃt]EPRRMQyà tASEPMA^t&jh'hBEPRhvM Qe[^_]UVS]u 9s}P Vzse[^]Ít&UWVSu }1Ʌt+>}9U 9V}49U|C9F~W9| ًYuڅuf}F[6};FCFCC P F C &&F Po Vi  AFqe[^_]Í&UWVSut`WjvË++S0} ЍPSP:C U RPMSVe[^_]Ít&UWVSUËG5p(9ttK<[t%DF tat&&?]uOjƋU++~U UEPj lj~ 0HFVURe[^_]Í6UWVSUE0U:ЉE6HS)‰)EKM[uUREE1Mt[SU3)~VMPURu CPC PMQSU{GC P*S$]uMPURMPMU MJUǂe[^_]ÐUWVS} ѡp(DPu -EP} W}W 'E} }EU}9~jh} Wh})9~jh} Wh)ȋ}y}0U HE}Ky }}9t94؋}W} WP tWPpt t&jh} Wh}W71e[^_]Ít&&UWVS0ҋ}щHE}щHEu 1ۍ6EPVƃtuCt&&u,jhEPhEP6&0} ҋE+ERE}EPE Pƃt.+] SE PWߋEPW}uu t&E PWEPEPEPEPËEP&؍e[^_]Í6U WVSu EEE]<$u{ EСp(DP}jjW]SEEu ]]Xt&-uNX]HP$u E)6p(DPjjWQWEE8m]9]~\v&]]0PlEMp(DB tvFDB uE>ujjVMPǃ M?t"wp(DB t 6FDB u]9]n}u>uc}t]9]|U}t']]SEPM.]Mt(9Mt AE)RPQM+EM E>?]9]}9]|]Sjh]Sh E&t&&jh]Sh6]S1e[^_]ÐUWVS}}u{]ލ6WCPu3U 9Su+jhPhUR#>EPCPCP t}u]떍v&1e[^_]Ít&UWVSURNhURp EPEPUPR019u~O6119=~$EPPt C9܅uEPURF9uEP^jh1URÃu hAC4h'URu\j$t PUR'j#t PURm'j#t PURR'1e[^_]ÍUWVSu] U}tMEPEPRVt1q6&EP_1[v19}~FEPSC,Ѓtԋ@ ptjh1Và }tMtG9}EPe[^_]Í&&UWVS} jh1MQDE u hhpEPEPWMQ t1>&UMM~E8wt&EPBPCÍEPSEPMQEu%jhShMQEPSYvSUE|}u E@4EEURWP@0ЉE }u4jhWhMQEP1_&&[ƅu hKjDËM MKsh@VhWMQC jCP Shh VMY jhhV }tVtVEMQEjjh.VPMQjjjh8VPjh8MQ0~tMFAF&jPMQR VWMQ1 EPYe[^_]Ðt&UWVSjh1MQà u hBѰDž,Dž0[44E v&jhsuPhMQt&&} ]0Ѝx:-,zsu/WhR uvDž4st&&WhP uvDž,Bv&jhPhuV&& 0u M9$0u&Ph8S0 4V0QuV uj0QuV>1 [^_] U WVS}jh1WE u hEPEPM QW~tjh M Qh6U(u&~t&&El6&EPBPÍEPSEPWƃu)jhShWVEPStt&SrUETERP@,Ѓt,@ @ PVORVuEP.1&6EPjhM QhWe[^_]Í6UWVSu }9}0vPUR{t&C9|1e[^_] U8WVSujh E PE uLjDEUBE BB jRURhh E Pt>uU} t/jh'URh,h5EP]&URE PURO>&j !E0ۋ}щMQU щMQUJEPRVE@PEUBBE B ~dREH1ۃ9] ~Eu$6>0щMQmUR PURPp C9] URhEPU REP"ti19] ~6URPC9] UJt QEPURRvEPmt&&hURhEPU RuEH6}WUREPUR@҉à }uC PU RgSq }tEXC j@ƋURE FWRE8PURh҉ }t؉s EXE1e[^_]U WVS]jh1uVE u hR} jhPhvjCPuVuV}ƒu$jh CPh } uC PRuV&} u*s&uC PRuV(v} jhPhi6&EPCPuVuVUUt,CPE PCPC PEPQRV)t&&jh CPhuVe[^_]Ð&UWVS}E ujh Pdà u h葨VCPC<Ѓt/p jFPW~1ۃ 9^ ~FPW'C9^ 1e[^_]Í6UWVS} ujh Wà u hVCPC<Ѓu jhVh,UR,v@ @PW#VWzt h4蹧1e[^_]Í&UWVS}E 9t'jh P;à tPWuYv&jh1Pƃ u hb.~(uC@&CPW1e[^_]Í&UWVSu} V~jh1V葾Ãu h辦jWSVQujh WhV6jh PCà u hpURCPC<ЃujhWhURh,MX u h/CPVt 1-VjhWhURh+Ve[^_] UWVS}!jhJMPhM Q MYjh1M QJE u hZv0HE;aVPhS u#}wMQMQM Q&޿ Ev.jhMPhM QO&&}uJjMAPEPM QTǃu.jhMAPhM Qv&} jh W0à EPCPƒ{8uB&BPM QEPƒuY6&;cu;MQhSt u%MQMQM QE ;du;MQhS4 u%MQMQM Q ;eMQhS uq}vk}~%jhMPhM QJt&}fjMAPEPM QEjh@6&MQhSi V}L}&jhMPhM QjMAPEPM Q*ǃu!jhMAPhM QuE PEPmWUSWS~9} uJM Qjjh.WPM Qcjjjh8WPjh8M Q0t%M GAG jPM Q W9W6&;iMQhS }~'jhMPhM QL&}uJEPMAPEPM Qǃu)jhMAPhM QY&Ex4ujh&&jhM Q16&;s'MQh S }Ev(jhMPhM Q]&}uJEPMAPEPM Qu+jhMAPhM Qkv&EPEPsƒ&6Ex(u B BPM QEPgƒu6&MQh"S }}t&jh(MPhM Q[jMAPEPM QÃu!jhMAPhM QqjMAPEPM Qǃu!jhMAPhM Q1jMA PS u*9] jPM QS-&PWt&;tMQhKS uQ}t+jhRMPhM Q@t&&MA PAPM Q}&;tGMQhfSp -}t'jhoMPhM Q(&jMAPEPM Q:Ãu!jhMAPhM QjMAPEPM Qǃu!jhMAPhM QEjMA PS u*9] jPM QSlt&&PWEfEPS!9] t=jPM QSX'jhhMAPhM Qe[^_]UWVS}!jhJUPh]v&uujhUPh 56jh VE u hUZ0Ѝx;aWhSf Et t&Dt&jhFUPh6&UBPVU Rv&jh1U R0à u hm]EPEPUB PBPSU RVRAWhS uM]SEP6@ PU RSu;eWhSC }jhUPhvEPEPV腽SV>S9u uJU Rjjh.VMPU Rjjjh8V2Pjh8U R>0~t%U FBF jPU R ViV6&;iWhS# }~jhUPhvvjh1V#à u hmP{4ujh&&jhU R01-jhUBPhU Re[^_]Ðt&USEjh P茰à u h蹘CPmC CP]]ÍUWVSuuEPFPFPpǃ u7jhuPhuFPhu VPuF uu}nt&&Ë}ߍPEuu1ҹ9}uFuBA9|9U~uuBA9Uu^S諺S5uVWSEPEЉNjpuYu SRǃvDSu 0)6u RvWhwPT u9ut uVK9] ubuh&S>u Vkjjh.SPVjjjh8SPjh8V0{tu CFCt&jPu V SSPe[^_]Ít&UVSuF@ PtFPFPbPZ1ۃ9^ ~FPDC9^ Ft P.FPVe[^]Ít&&U VS] uEPV8t(@ @ PSPS<EP@uVEPF8P t3vX PCP蝲PCPEPF8PuЍF8PSVee[^]Ít&U WVS} uu h^ t6FPCC CF PPPPf^%&&@ @PWPW<EPSuVe[^_]Ð&UVS]jlF4jVPjF8PEVh`h1S1e[^]Í6&USEu1$jh1P賫à u hC4]]ÍUEtP]Í]Í&UME Utu 1]ÍRPQ]Ít&UWVSu} tu 15&jh1Và u h0jWSVe[^_]Í6&UEu1]jh P質t]Í6&1]Ív&UWVS}utt } t}uE6&jh1VSà u h耒URURURU RSVWWe[^_]Ív&UWVS}u tKtGjh Wà u h<VCPC<Ѓu(jhVh,WK&&P }tBM}tBM}tB M}tBM1e[^_]ÐUSMU ]t49H u9P$t,t9H u6&t9P$t@Tu1]]Í&UUE tBt]Í&tK]Í&]Í]Í]ÍUU1tSt]Ð&tk]Í&=uj6 ]Ð&=uj ]Ð&=uj ]Ð&UWVS}] uj r‰rG0BW0e[^_]UVSu ]MQ01t292u$9ZuuBA0R&ЋRuύe[^]Í&&UVStrsThfhiSj{,Sjj @t&S S(C$PC PjCPBC C$CK ue[^]ÍUVSujhsVkà utj4CjS衻ShhsVpVj uEjt PVjt PVjtPV؍e[^]ÍvUWVSUUEP&Ur ^XEtU{U 9SuA}u ~X UzSh .V*jCP裲S &]uURNF,PV,HFF| VU REPUREHURoUR~e[^_]ÍUWVSu] jhsVŤƒ tlPRB,Ѓt\9X uWP衺SV%C,HK,H 9S4t B9~K@GG|SVt &1e[^_]Ít&UWVSu] ߃;u hy`VEPPRB0Љƃ}u9^ th.~ G,e[^_]Í&&UWVSU U:susztum1u ujBu u j&u u jtE]SURP@,Ѓ ujh] ShURf16@ }t P]e[^_]Í6UWVSu j`Ãt'0PVP vhC}tC}tKCC CCCUSUS US$US(C,C0C4C8C<C@CDCHCLCPCXC\CT=ujhYlj_uj4t&jIuj&&j)ujS؍e[^_]Í&&UE]Ít&UE@(]ÍvUUE tuB$]ÍB ]Í6&1]Ív&UE@]ÍvUEU }tRc]Í&@t*xDuPDPH+x@u P@t&@tx4uP4BB ]Í6&US]{8tvS8B C8jRS^ {8uC8C<]]UWVS} EG tjPa W4tB9t G@tB8u@F8}O붍t& u}Gu} ; 6&} ;C}g|v&hf|}GtW19}Qv} 89tA9|9}=}O)ȋ~)ljF~vVD2}8Gt z~Bˋ9Fu F }GDuGHjV}W؍e[^_] U WVSU1M ANjȉEM69}G}r}ty} v&8Mu }< u)M9t)M AMb< C&8Mu}u@? y8Mu}u ? ug`&8Mu}tJXt&< uM9t+>t&&< u M MCt&hUSzUGMe[^_]ÍvUWVSu} E1ҋ^DF Evt#EPEPFPFPSV%ƒ[ tمtE Ee[^_]ÍUS]6EPSj~cWv&CtEu>7 t uCSt uK]]ÍUWVSuFt P RF6&Fuj Q&uFf19]~^vE)PE PVǃ u9Fu?t u6FVLt t6&9]f؍e[^_]ÍUWVS}GtP'QGGu j QuGgW8ƃ|u G u1ivU RUPM QٺMU  M1ۃ9})PEPW 9|~ U| uKEPM Q茺؍e[^_]UWVS]CtPGPCCu j 6 t jt&C(xujoSD1tv+BƋR uS81Ʌt+BR uS4tB9~K@C48+xt tj}u)u jSCǁ{EtTEEC(PtjC$PC PCP҉EEC$C}C$PMcjSj t=&S(EP}W} WC$PC PCPBЉƃu EPN}tDKEC(PtjC$PC PCP҉EEtPNt&e[^_]Ít&UWVSuFtPWNFF tju j t&F(xuj{vVD1tv+BNjR uV81ۅt+BËR uF4t +HÅt tj*6V(EPjjF$PF PFPBЃuEPMu  &)e[^_]Ít&USU1ۋButR4u؋]]Í6UE@ ]Í&UE1ɋPDt+BR uȉ]ÍUUE =~B\]Ív&UE@\]ÍvUWVSuF } u1J&0} Ѝxt%vcM ybuZWhiQƹ uGuhiMQ赵&Ft$PMQ蘵t:|t%vwM ybunWh(QZ u[uh(MQIFth3& t h8 t&h=MQt4t%vgM ybu^WhBQڸ uKuhBMQɴF\PhN]S\SMQ誴tH&&t1M yeWhQQb uhQMQMFuu MQҶFtHFu"hZMQ. Ph[|S薺SMQFt:FuhZMQƳ Ph[xSVSMQ褳Fu~MQutCi6&t1M ytWh^QB uh^MQ-Fuu MQ貵FtJFuhk0t&&u hpt&u hs t&hxMQ²FtJF uhk0t&&u hpt&u hs t&hxMQrFuuPMQGu@F(PtMQM QFP(tjH&&1l[^_]ÐUWVS] C tjWH&0}Ѝxu~bWhiV蒵 EPuVuV螚 }t E vE1ҋC(HtEPC$PC PCPщƒt2RG}XjuVGPh{V腩9}u*cC$PEc6&K&7u~bWh(V薴 0}Ѝxu>fu'Wh=Vc ucDt&&u>lu(Wh3V4 uC$ Cu>nu(Wh8V uC$ C}jhhu6vKu~buBWhBV讳 u/jj juVC\=xC\lvgu~e WhQVV EPEPuVuV^kEuCC&u+Ct ECCtwECj&t;}tjhhuV@EPl Ct ECCt E@CE[P&Gu~t:Wh^V6 #EPEPuVuV>KECCE0kuCv0uCCt&0xt׋0pu C80st0 tt&CCE0ku)C(0}v&00x0p0s0&t}jhhS EE8EkuSCt&&EuCc&ExtrEpuSCZt&EsuSC0t&&u SCC!EP:пkuC(0}пuCC &пxt׉пpuC }&пsu C R6ֿ u}jh(h5h`uV赢p&EPϲ1QvC(PtuVuVuVCP06}t#jhhhuVh+uVGe[^_]Ð&UWVSU ZX1tV6sU9SuAu U rXt&wSh .U RjCPËS &߉ue[^_]Í&&Ujh)h( V]Í&&UVSE EE6sTCPtPCu1SDt*9B}#EP:XCPt*jjt&&S tCP PRCPtS$t PRCPt/S t PRS$tCP PRJe[^]ÐUWVSE 6{T1CPt9CuSDt9B}v&C t jP ƃCPt{8uC$t jP ƃCPt(C t jP ƃC$t jP ƃtjk*Xp jPT Be[^_]Ð&UEjPj]ÍUSE u1| ]SEEM RLt;K Jt#BEC PB PBЋUِ&R̍t&&E]]ÍUWVSu}]=u*jh)h(Rjh(ESLtv9u 9ru9z tRuu!j Brz CLBSLM JCPSLt6J KPRue[^_]Í&UWVSM E]1SLt9u 9B u9Jt ֋Ru tv9uBIut9u BCL t&BFRCPSLt6z {PRue[^_]Í&UUE M@Xt$9Pu9H u@]Í6&@u݉]Ðt&UVSuM EYX1҅tR9suC9C u>9YXu CAXCBSh .QjCPӆS%t&&ڋ[ue[^]Í&&UWVS} u_Xt8U9Su$9s ujCPtC&[uͅu"jSh .VWGXC_X;USs 0}PɤCURPܢe[^_]Ív&UWVS]US Us{URWVރWCPtURURVV?UR蝄W藄V葄e[^_]Í&UWVSuEvjh8PhR&V0Ѝxru"WhjR讦 ut&au+WhsFP脦 un&&wu+WhzFPT u>&&jhFPhM Q觚&jFPM Qaƒ u&&Bu6jztjPhM Q3Y}uWRM Q8&F 8tPWRM Q,v&WRM Q1e[^_]Í6&UWVSu }+jhMPhV蓙&&MY0Hp1}~jMAPV, ǀ;iFpQhS蜤 }t#jh MPhVnMAPV裙G(PV藙Gth  &hZVuGt h% t&hZVUGt h+ t&h7V5Gt h3t& t h8 t&h=V} h@ t&hZVGt hL t&hZVŘGt hP t&hXV襘GuhkV萘GtWhbUu hxt&uhpV`hZVU.u)hsV@GthihZV%G u hk.t&u hxt&u hpt&uhsV1ۋWDt+BËR uShNtSSV譗1ۃG4t+XW8t+BËR uShNtSܤSVmW'PhNSä$SVQG,PhNS誤S;iu{pQhsSѡ ub}tjhV?v&1ۋWDtv+BËR uShNtS,jS;mpQhSM un}tjhV軕.Gt h vhZVUGt h% t&hZV51&&;nuKpQhS u2}tjhV/v&j&;opQhSm unjhsVqà _EPSJJv{(u@PVfEPJu&&;ou{pQhS ub}tjhVOv&1ۋG4t+XW8tv+BËR uShNtS0jS;qu[pQhSa uB}tjhVϓBv&j$GV&Lt&;rpQhjS u~jhsV!pà EPSچvx Gt {(u @ &PVEPʆu&&;ru[pQhSa uB}tjhVϒBv&G,PhNtSӠjSN;tu[pQhS uB}tjhVov&jG(PVR&;wpQhzS蝝 zjhsVnà EPSvvvx Gt{(u @t&PV膒EPju9&&jhhSh+V舑d[^_]ÍUWVSEv,jhUPhU RAjUBPU RE UZ0Ѝp;aVhSZ }t!jh UPhU R趐|Ur j u G6Ur z t)jhCB PhU R`&t&&jܘËUBXCZXU Ss 0UzP詘KUBPQ跖Sh .VUR1&;dWVhcSC @}t*jhjUPhU R蟏ev&EPUB PU R,~ ;M})jhUB PhU RM&1UZX9} t @[9|u$jhUB PhU RvUBX9uCBX:&&ƅt6F9tƅuu hSCFSh .URjCPzxS̞ ;lVhS }t*jhUPhU R?v&UZX36z{ ujPU RƎCPU R蹎[uv&;rVhSC ut}tjh!UPhU R裍lUZXt.6sSh .URbjCPWwS詝uԋUBXj6&jh9hYShkU R5e[^_]ÐUWVSE}~#Urx u EE9|9]#jhUPhU R踌/v9ucUt0HPhV t1jhUDPhU Rd EEH9uv&U4CEPVU Rǃ EujhVhU RljUPWQ |*}tjhW7 |1=jU R)Ph WPh$U R脋e[^_]Ðt&UWVS} u}tjh4Ph@v&EPFPWà u i6Eu*jhFPhWD&Sƃt&jW(Ph SPh@W車e[^_] U\WVSu]FvjhQPhNt&PCPU R<ǃ u~6&u'jhgCPhU RIt&tDž [V苐VWà }`WUuNWxuAVjU R'Ph WPhU Rt&u"PU Rt&hPRU RuP聑?v&U R臋Sh]SjSU R܈P=1[^_]Í&&UWVSUEv6jhPhPhM Qx&&Džrx uDž9]t(PPM Q t(ujhgPhqCDž$9]p(DPt*$PSM QYv !6&޿ t]jhShM Qg6WʏjM QO%Ph  QPhM Q(vDž QJ,S訍1$9}Rߍv)9}3PW؎S,P QG9| $9|V,S蚎SM Q0S~tM |0 uD01[^_]Í&UWVSuEFvjhUPhu]SUBPU RܾE t_EujhgUB;&SUBPU R蟾E t"Eu/jhUBPhU R蓅$6&EPUB PU Rt tlǍv&V肕jU R?#PUVbjU R#PURbPhUPU Rbt&}}Ehq1E~Mv=~PVURà Tt$SVUR \ߋE)؉EV谔WhU P菒1e[^_]Ít&&UWVSuFv,jhMPhM Q![jMAPM Q޼E /EPMAPM Qr 1ۃMQ 0Ѝp:suVh R ~cu)VhMA P uY6&eu+VhMA P u+t&&jhMA PhAM QQ6SEPMQ | 1;&jM Q Ph MQ#PhNM Qe[^_]Í6US] E}u0j@PSt t2PPhP衐1t&jh4PhS[]] UW} E}t jh4PhWVt&j@PW tPWƹt20H~| uD벍&1}]Í&UWVSu~$)‰Ѓu8t3jheUPhU Rh0&&jUBPU Rǃ ut&&u[,S过SjWVtjhU Rt&SU R膉S@t&&u[,S_SUBPWtSjhhhUBPhU Rn9&9}'vUPDPWU Ru 9|1 [^_]ÐUS] U}u=EPBPS߸ t=P%PhP1vjh4PhS]] UWVSEDž(9]~]:-uTֿ, t1ֿ9t^jh<RhZ3 Dž(C9]9];jhgPhM Q6&C͍&1MT:&uzu IMF1҅u RPE)PM Q$tt`$QM QЮ$QM Q谾e1SʆjM QOPhM Q=~5&j$Q蒹tn,S迄11WS h,P$Qv=V,SЅSM QfS $QM QݽƋM 0ЍP(u~| uDM x[^_]Í6UVSu ]}tjh4Ph[t&&EPCPV tAEt%P%PhP 1jhgCPhV|e[^]ÍUWVS} UuBv&jhPhW|\Et$^u!EPF PWj t "61V:|u@uEPSRW ÃEPEPBPWrEPSW u16&t3tKt&&t+96&66&&6&6&hV@SEPEPWÃEP~tSW訳jS耶PW&{16e[^_]ÐU VS]uVS{nt@ @VnuSmS e[^]Ð&UWVSu} jhVTWà u%j4,jSlSh OhVYVEPWSC0ЉÃ }u hF?{ e[^_]Í6&USE] jhPV tSP@,ЃtPl]]Í&U WVSE]ptz8WaVaSh]SU RV3jSh6URh6U RPh6WVYg@tVU RVR VibWcb U Rj襹e[^_]Ít&&USEËPt PRjP cS^]] U WVSEEEEE9]!6U8-ƿ8u2}EC9]GUƿuC9]#UUt&ƿu=C9]EPhUPU RJtT*6&ƿtjhPhU Rwt&}EC9]}tUU}tcjh&~&9]~UUC? jhNUPhsPhU ROw7v&EH9uȍEPhUPU RO}j0}PNjURW}>U VVh0PUREPU RߵÃ$uWVt&VU RVhPS蚫6UREPURUREPU RCÃuZBt&jhl.&jh&jh&jh@U Rvt&&SU RfjS>PU Ru1e[^_]ÐUWVS}u E]PV诃t f@%1A SVW8d u; 1t&jhWcue[^_]Ít&UWVS}EuV]SjjW賃E 9E}EjE PjjWEVSjjW{E 9E}EjE PjjW1e[^_]ÐUWVS] uUE };@C;u Ӆ@jSMQRà >M$tPS路ƃu>jtPhSrPhMQtt&&Sҷ&;u Ӆ,PSMQNU tVPƃ 6&1,P|u;jMQPh#Sh'5t/Ph:MQTs+6M$vjhDMQh^MQ's1 [^_]Ð&UWVSu U1ۊѡp(DPrt_ at&wuADt&AU0}jhnVhpURrht&&F<+u~u&u&EPEPVURht7} hURo_VURe_hnURW_6EE9]EUURu$ƿuE6}Wu*ƿu$ÀEr6}Ru*ƿu$ÀEB6}Au*ƿuU}Cu*ƿu@ }Eu*ƿuˀ }NuJƿu ƿ u h&}TuƿuB6}tjhh Ph<UR/pEP[NEU9UEP0}u}tjhRhkURo믍6؍e[^_]Ít&UWVSDž }W1rU V0vVU RWQÃ9tjVhwjSV/vEPSjx ut(P %t&hhSWÃu6WqjW Ph#U RhWn&E@P^w EP RSƃ}6SW߮jW Ph#U RhWn & SW蟮ux RW RƃuWaƃ,t&u#GPU Rh$S:|SW[[ R(~PTv5 t R~P v[^_]Í&&UWVSu} 19}&6j v‹BC9|܍e[^_]Í&&UWVS51tKjEPPm tu=t( tvҐ^u _V}ރ뱍e[^_]ÍU(WVSuDžDžDžM 9}艽vjEP}P uHDžVP =t( ujPhV1l]6&Uu DDžPhQz UuJt1%Ph]SyjSWhVn DžBf=wWЃPPÃjSEP0NPQh&VJnjh2Sh4Yt&&u[tk%PgPÃjSEPMPWhCVmjh2ShMVj,&tjh_Vj M 9/Dž}jj}W& tihSMQI tLDž|$Ƅ(jSVSjDž 뼍t&jV8PhV)j}Wj[tut jhVi[^_]Í6UWVSEEEEEEEEEEE}t ]}t }} t ] EE1} 9}]]6}:|uRBt <&uGzuAE@9tE H9u!]&&uE_t&}<<}t}t ]SEE}zhEEE}x>u#|E1ɺA&&@|A|;&uEC|EPEP}DPR]PQ|W]SE nu,}"|}t]DPEPm}tjj}W] t$}t}t }W<]]}̉}} }t}t ]S}}u ẺEEt&<2z>}t}t }W蹫E]x|x>u|E1ɺA6EAEPEP]DPR}PQ|S}W'E t}tjj}W Eԍ 09M ~|+|]A9M })} ENEF9u <} u"](/ t}t}}t@]SǫEE}uyj}WPhJWv&}tOtEPEPuj}WPhsWv]ĉ]EE}}uj}tduEPqM&EPEPsuj}WAPhW26]]EE}} t?}u9j踪] uj}WPhW6EE]P^lE~EPEP}W]S}W]S} WEP]S}W,}}t}t ]S̨}t}t }W质}t}t ]S蜨Et&jhh}W&&jhh]SbjhDRh^}Wb}t]tP"}t}tP} t] tP}t619u~#E8tPjEEF9u}W|rEt&p[^_]ÍvUt(]Ít&UEt(]ÐUVS]t(Pm;&2jVPhSde[^]ÍUWVS]uEEE1tMEtUU1tEPURQEPSU RURtÃtOt}ujhh!&t(}u"jh5hTUR`8&EPSEPEPEPʕu\jhrUR` ~EPS"EPp Et P詢Et P虢EtP艢1e[^_]ÐUWVS]jhƋU0} PhFU RPfUVڀV ^hEPVyPU RURo u!FPpV p:t&&VhPkjqU RUR+tÃtFPoVo؍e[^_]Í&UWVS}u jhPkjVWuÃtShPkjqVWltCP{oSuoe[^_]ÍvUVSuE jhPkjPV2uÃtjEPS}PCPVne[^]ÍUWVS}E@tht#GPnWn jEPW PGPM QknWhPkjqGPM QrG t0tt&t t8CS9vGGD@%njEPSrPCPM QmLu*jEPW>PGPM QmvjGPM Qqlà u&&VdjM PV6dM Q_G ~ t'6.i6&GPSM QK VM QejEPWaPGPM Ql8GPSM QL t;VM QQejEPWPGPM Qtl0v&GWOH&GPSM QL t;VM QdjEPWPGPM QlN&WGVwt Pl0P`dSPwb v&6&PM Q@d1[^_]ÐUVS]u C tM t&tk&CCPhoVTi}&CHSKVCSPRPeR&CCtr2&t6&Cu v{e[^]ÐUpWVS]Cvjh~}Ph6P}GP} W; u z6,P`XP`P` Dž~}G8t?uu} 6} uR}G PW/u2jh}G Ph} WY=t&WPf}_wp(DPt * t&&p(DPt *9 u Sv9tL?tQjhGPhWh4} WX6&;t"CF`t& jh;W5à t&t98V@u냽?u'jhC}GPh]} WWt'j}GP,P^ v&,PW譳PPW.L 9luyiu ybup(DCt BDCu9u5PqgjWhg} W"Wt&)PQ,P]P*g, t2p(DHt )B tp(DHt *j,PXS{]jhSn]j,PSY]$j hSI]PPPXPW} WCƃ$,u-jXPhW V=ujhxji^0PG^WPR\0@P%^‹W,PR-\GG GG=WtgGt WajhGPhh} WT 16&WG Љƃuu} 9tjW3WjjhWcP} WAjjjhWmcPjh} Wyd0jP} WRS uAjh;W0j\8XPhxh;W/ ,P^\XPR\PF\P:\[^_]Ít&&UWVSu=ujhxj \j\0} P[CCU RCPZUS USCt,jh;V/j[xPhxh;V.e[^_]Ðt&UWVS}] u` jPWRPWzSCPWpSjhWR([u SWu"jhShW_R`&jh;P.Ƹ  t;jPW)RPWRCPWRjhW R(vu1e[^_]Í&&UVSut%6VCPZ_u C[u1e[^]Í&&USEtXPa؃u]]Ít&&US=t4vCPraCPiaSca =uϋ]]ÐUWVS]DžM P\(1~M A8-t KM E PKSLjVhP`V`Sh]S^(jShPf`juM Ph PH` jXDj(u t&Rh*P`PMуt=j[Ãt-jh:SejPSUjhgSH$}WPvjÃt>hiP u!EPFP4CEHƃsvEPFP}V69]u_jWG Ћ_WUCFEHMH&&}jhURBU JM_M11e[^_]Í6&UWVSu U$UM$YEU9UvMU M&FUhtSvM$9YuYjQA ЋU$ZuM CF t&BurURVMQ$E u U20}ЍxU$B)9ZWRB ЋM$YURSIt&u}]EW6u;M$YQURMQFPUR_M1U$Z-&EPVݝ~ .uCMhu;Et%}gjhURt&&}]v=M$Yu%QURMQj"FPUR-@&t2~ (M$QURFPMQ;UM\ux t[EhGvH>"ujhURjh2MQ?ut&&U2M$YCMU$9 t4}|&U UMD;FFe[^_] UWVSDžT] C {uO{?}t;;u/jhUURO>}tU1&C;}uƉލ^C ѡp(DP u_t9u}tU:{3ހ>(8($U,Dž00Dž4$P Pjj)FPURgtP)d~dWPh}XSwLSUR+1$T}tp UcUR@ $T}tUUt Gt&hTRWURLLjTt8$9tQMH[^_]UWVS} uWUR: Ãt?jVP tNjVhPhWhUR@=*6&0PEVPC1e[^_]Ðt&UWVSDž$, 6U RUR ǃ?!1_tPtjPP ~1}t)(PURP t}u (tދ[utt^S[$SUR*S5%t(hURq)UR>U RUR ǃ $Uh RvBjS RBU R R'Cjh RtB$jEuP RVB }tjh R:B ,PURw) RC t(h URa(UR=$ 6&?u;jU Rh*UR:}jURhUR:it&}t)(PURP (t}tu4&jURh>PhFU RhOUR;:1[^_]ÍUWVSM M}jhn MQ20ЍXfShR7E 9}N6MPE4PM싁`Ѓ&p P%,t1PI&^CFPIjCP$#SvI~uVgIG9}iShMAP}D jEvjhvMA PM Q0}u/MAPE4PM싁`ЃAp t&MAPM Q@ƃ^EtGjMA PP u$}jCP"v&][u}uTj @0My P@‰MA PR>}u FC^ MACY0MyPB@‰SMAv&nShMAPB }tjhD&]4EPS*6p >u~t"{(u @ &PM Q7EP*ut&&pShMAP=B Evjhv}u:MAPE4PM싁`Ѕp t&MA PM Q MA PAPM QrShMAP}A }jh &Mq1Ҁ>-u2u1ۍB9Eu3M\ SM QUoUt5t&&}uuRSMDPM QcÅtȋM vuSh9MAP@ }u$M싁h&&}uzM싁ht PEMy?uMǁho&0PD=‹M쉑hMAPRL;7 jhA`t&vShUMAP? unvi}tjh^#&MAPM QMA PM QejMA PAP8@vvGSh~MAP=? unvi}tjh&MAPE4PM싁`Ѓ"p ^PM Q 4[uvShMAP> }t+jhMPhM Q3ft&&MAPM Q@MA PM Q%EPMA PAPEPh{M P@8jhhhMAPh)M Qj2t&CM 1e[^_]ÍUSMU EPR4PdЉÃ }t$j:@C t&&C ]]ÍU WVS}EP4PD%tap t8PA-&^CFPAjCPdSA~uVAEP%u4Pp$htPuAe[^_]ÍvUWVS}u p(DBt4N~tӐDCu.uA9uy.t 1&jh6Vh8W0e[^_]Í&&UWVSuM E61E>t?6.t6]ۍDЉEF>u&.tDҍ<A9u9}u1>t F6&9t9tAE넍}t19}t~ }u]9}~ t&9}t t&1e[^_]ÐUt(Hy $&Р@`00@P Т `P ``@@P`p@p00П0С p0@p`PpP@М PОp0 Н`pP &Z]Í&`]Í&g]Í&r]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&&]Í&+]Í&3]Í&:]Í&A]Í&H]Í&N]Í&X]Í&e]Í&k]Í&w]Í&}]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í& ]Í&]Í&!]Í&*]Í&4]Í&@]Í&G]Í&N]Í&V]Í&]]Í&e]Í&l]Í&s]Í&{]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&"]Í&(]Í&5]Í&;]Í&B]Í&R]Í&]]Í&d]Í&l]Í&t]Í&~]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&UEHy $У6&@Щ  PЦ Хp p``@ ЪШ @P`0@ЬPp0@0pPp`p0P0P@`P p`0Ч@0Ы`&]Í&']Í&9]Í&P]Í&o]Í&]Í&]Í&]Í&]Í&]Í&]Í&3]Í&F]Í&]]Í&n]Í&{]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&3]Í&P]Í&k]Í&}]Í&]Í&]Í&]Í&]Í&]Í&]Í& ]Í&&]Í&>]Í&O]Í&Y]Í&u]Í&]Í&]Í&]Í&]Í&]Í&]Í&']Í&N]Í&]Í&]Í&]Í&]Í&]Í& ]Í&]Í&.]Í&A]Í&O]Í&_]Í&]Í&]Í&]Í&]Í&]Í&]Í& ]Í&]Í&3]Í&E]Í&X]Í&l]Í&~]Í&]Í&]Í&]Í&]Í&]Í&]Í&$]Í&=]Í&S]Í&k]Í&{]Í&]Í&]Í&]Í&]Í&]Í&]Í&4]Í&>]Í&\]Í&h]Í&w]Í&]Í&]Í&]Í&]Í&]Í&]Í&&]Í&F]Í&`]Í&m]Í&}]Í&]Í&]Í&]Í&]Í&]Í& ]Í&"]Í&?]Í&N]Í&`]Í&t(P$]ÐUEH`$6&p0@`ЭЮ@P P0 `&t]Í&|]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í& ]Í&]Í&]Í&#]Í&+]Í&3]Í&=]Í&F]Í&N]Í&V]Í&UEH`$6&p00`  @P@P`pба&t]Í&e]Í&q]Í&{]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í& ]Í&*]Í&:]Í&M]Í&Y]Í&p]Í&u]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&]Í&.]Í&=]Í&U]Í&V]ÐU=h t)PPa(Pl h ]Í&UVSu1ҡP l 9}v90t@B9|l 9h uwu7jhj L Ph Ov@vt&&P ËPh PRS PP'P%h l P0@@@ Bl e[^]ÍUWVS1P l 9P1ې}98Bxzz}UI l l 9}(PTTTTT T }t[}t }hu}W&At&&}W}+t&F l 9L}Whne[^_]UVSMu 1ҡP9l ~5X v9u{t QhC33B9l уthuQ%Q֍e[^]ÐU$WVSE}t*jhEPhM QoTt&jƋE F0ҋMy ҉UR‰VE@ PRF MQEPMIQE P à EE9])vMQEPME QE PY Ã\MMt U:?u/EP$jhMIQh6E P v&0Ӄ}uz t&&1ҍDPǃ}u ~ t&M9}EPGP}uDGURRPGEP#EM9MhVhE@PM QEP#1uMQ#jhEMPhM QXFPv&~ F Wj#~ uV[#UtRK#؍e[^_]Í&UWVS} uE1ۅtX4<#uEEPGPVw u}}ejhWhBMQv&Сp(DPt!EPWV& u+]]&K]EUu1.v&x69P4t@DubMEe[^_]Ív&UHWVS]}U U&jhNPhM Qt&EPGPURƃ ut&&C)t|MMEUuPRƃ$WSYSMQSm!uU BPhj]S@SM Q^MUe[^_]ÍUUE PB PB8Ѕu 1]Ív@ xu@]Í&1]Ív&UExt1]Ít&&@]Í6&UWVSMP9LjEPHt @4@E 6EMM}}LEEEǁPW MH6:ukzDD߉uG}}EHQ}W jSDQ} WeSESv}~ H B%jSBP} W@@HM@}~*jhMPh} W6PAAP} WƋPAxyH QKu#LQwƃ&u;LGPMPhTSS} Wqt&&uKLN&jh}PhBPhM Q 6uLELEtEPQ6LEPLQ64[^_]ÐUUBHJHR]Í6UVSuFPF v&Pp؃uVae[^]UVS]ǃuJju>PjhCStjPjhMSe[^]ÐU WVS} u1Ep(DB t GDB u<{u <"uEGt< "0<  < &<\<"6&<{t <}tvC6u{)F‹ p(MDA V9sCt%MDA t}8MQV)PhWMP&(K"6EPVFgEHƃ&}6&})F‹ p(MDA Vv9sCt%MDA t}tdMQ/ hV)PhMP>6t}t2jh &}t*}tjhMQT g&)v&Fv&p(DP tp(vFDB uM9M1}tM1e[^_]ÍUWVS}] u~3<\u$EPSeFU\G)׃t&FCOe[^_]Ð&UWVSEu >tp(6DB tEF>uEMM+E DPE1uEPEPE PEPR]SFtMQE Et&&U:ty9}3]S}tjh MQav&]4}tEPRVuFVREPE@ƃ GU :?M] M91e[^_] UWVSU11u*ӊ<{t<"tu;v<;tr0< tl< < X&<$tL&<\tL <[t6}<{t <}trGi&OyYT&Gt&&Ct< u*&&EPSU3cEHÃUC;2tM 1)ЍEe[^_]Í&UWVSMu }tu{F}Fu&{V9tvAB9u}Bt&{}\F{VAjt&tP$6& 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000tX\BR6\BfK&\Bn;&\Br+&\Bt&\Bv &BA9)e[^_]U\WVS}UU6&MPH E}~.]1UUSM 1Ps|89]W Eu1ۃ9]~(vUPVM Pd F C9]9uuU FE9Et MQCEe[^_]Í&&U WVS19u~ 0ېE <щMF9uRM E}EE19u~vE  p(DA t 6BDA u0ЍX~ p(DDA tKtSREP ]E @E F9uE9Et E@EEe[^_]Í&UVSu] u> v>u <*t 1<*u,C;6SV>tF捶9t;~Pdždž0><8t0H] 9Nc 6SNjPW t P"6&9t PRuVt/thuP PFe[^_]Í6US]St.thuP t&&PC ƃ]]Í&UWVSu }vFt"SPjh+W ߍt&&e[^_] UWVS] u ѡp(DPu-u+VSUR0t mt&>}aYv0HPh5S t,jh9ShUUR& 1e[^_]Í&&U WVSu0U HE1ۍv}9 P} W? |th}􋼞 }S|2 6  $JyӋ}} }  t&CNjO} WENt'j@Pha}W1v&tP 0P V  $KyӋE@P } WP} } Ee[^_]Í6UWVS} u]jjSVWku$URjPPhURe[^_]Í6UVSuU M]~DPe[^]ÍUVSu] EPVtSSPV+6&e[^]Í6UEP @@@ ] UWVSu] }}0ЍxF9F8FPzEFPRMQ F 9tRMV M9s 6CB9]w~e[^_]Í&UWVSu} EPWWF@9F4FPËFPRSY F 9t Rd^SP9t CFEPSW Fe[^_]ÐUWVS]u }19s2FCPeNjCPRW C 9tR;se[^_]Ít&UVS]s 9tP3CCC e[^]ÍUVSu] VC 9tF1&{PR t&jRVK CCC e[^]Í&UWVSu ]~ }9t P0;ҍJNCtOt=hu~G~!R‰PRPCЋ~G~CBt&}>Fv&R~G~PP;ƃe[^_]Ív&US]CPRtjht&&jhS]]ÍUEjhP]]Í6&US]EU PRElPSzڀ:t p(<.t%DAuB:u.B0B]]Ív&UWVSU} }M@tV%=uRh jaMQMQW fflnLJxv&EPMQMQWƃu*Ejj PVÃCwd E9t8tAM싁xPh]SaEPSMQMQWC&ShlP&x1e[^_]ÍUS]M 9tRI<{tСp(DP t&9t8y\u29t,I<{tСp(DP u 1]]ÐUWVSUE1ۋ}MtEE 9&E{-t&8(uÐ@8uH8)t1&@8u1M Mu u t &‹Mt6EPM QRB0Љƃ t(}tFQÉ^ s 7&M QRB,Љƃt(uM<p ^ Ct[u,6&CtIMu!Mp t&&Cj4CjP "6uMx M }tMMtGCURWP@0Љƃ }tM)}tr{t SV.É^ s Tt&CWP@,Љƃ}tM)u1Mt| PMQMQM QMQ1 v&F e[^_]ÍvUMU E PjRQ]ÐUWVS}uEPjhdVWU RURgÃ{u Et*xt$% PWU RSEPURJuHCu Ce&tDtEt @u| Ct t vp PhdWU RURCt EPS1e[^_]Ð&US]M UE PRjQS]]Í6&UWVSUUEPjhiURURU RURAÃu1({ u*Utꡀ PhiURU RUR̍t&Ct)Utt PhiURU RUR뛍vUttUtF{u Et9xt3E% PURU RSEPURt PhdUtEPURpv0}Ѝp3C9|H<9~W!E{~CPUR(CP {USUt3C;WPet GEPWURJ vURCP3c{u Et[xtUE% PURU RSEPURt-PhiURU RUR1$ Cu Ct&mCt EPS[e[^_] UMU E PjRQ]ÐU,WVSMM؍EPjhnMQMQM QMQÃuj&&KMԋE܅txt P}CCCC}u E܅tyxtsCeE% @PMQM QEPEPMQ}t6UB ER}uM؋tv9u@@uKEtE @PEPM QMQ}~ EP%}uCMt;}up  | PhnMQM QMQEPSwEԍe[^_]Ív&US]M UEPRE PjQS ]]Ðt&UWVS]Uu}EPjhtPRM QSÃt&j‰:MJprCB S16e[^_]ÐUS]M UEPRE PjQS ]]Ðt&U WVSM U]uuEPjj%PRQVǃpOE6tpu91u 9Yuu9qt MI t&utv9JuA BRu}uA G A uF Q9GtjWe[^_]ÍUS]M UEPRE PjQS ]]Ðt&UWVS]M U}uEPjjE%PRQSuD6&@8t&&@t t 9pu98t@ u 698t̋@ u1e[^_]Í6&US] EUuhjBPS%t&&u+hBPjBPSt'1&jhzPhS]] UWVSu}jhPhU Rg.9}#vhjPU RuC9|1e[^_]Ð&UWVSu}1-jhPhU Re&&uhjGPU Ru3̐9}'vhPjGPU RtC9|܋U 1e[^_] UWVSu}1-jhPhU REe&&uhjGPU Ru3̐9}'vhPjGPU R tC9|܋U 1e[^_] UHWVSE}jhMPh&vM u#MAPE tPM v&MAPRB,ЉƒEtR UBtJMMAuEMQ20ЍXaShRh }tjhMPh[&}6MA PAPMQM Q Ã-{t C@ @t/CP&CuM 1M !␍t&dSh#MAP }t$jh.MPh&}fMA PAPMQM Q Ã]MA9uCA- R9ZuCBS&eu[ShNMAP uB}tjhUMPht&}M !&gShhMAPm EvjhlMPh[&}SEPMAP&ƒ6z GuVMAx(uZ&&Z}uMA PSjtSM Q GPM QEPƒu6nShMAP} Ev&jhMPhb }SEPMAP&ƒ6B @uIMAx(uZ&&Z}uMA PSjt SM Q EPƒu nShMAP} }tjhMPhgt&}FMA PAPMQM Q Ã=SuCP@ƒu6CB @uЋMAx(uB BM vsShiMAP }tjhMPht&EPEPMA PM Qxi1EtM jMPFPPEPMQf().C;ujMPjPEPMQ0ƒ0EE}j1e[^_]Í6UWVSuMAt1 }GGDž]; ;(uwC;uK;)unR+EPMQREH)lj E@ MDž C;z1ۋ}EM􉏸} tM} G}Wt=vB Ert(VMQ}WMQBPЉÃt @ta1ۋUu@t΀}}Wt=vB Ert(VMQ}WMQBPЉÃt @t 1ۋUuƃ} t} Ot PMaIE}؍[^_]Ð&Uj @@@ @@@@]Ít&&UWVSu>su~-tjhVhw&^Ejj PSǃE9tʀ8-uŋUR@PKt,jhURhVhUR8t&&U Bt 698t@ujhVhURS1e[^_]Í&US]{tvSBCRY{u]]ÐUWVSE@Et9E uEAEPM Qaǃnw FtR^CHKuACt;{u5C uS#M 9HtP2S~tyMQjM y(uG GPVjMQ~tvVB FR]~uMtv90u@@uFt$MQVM y(uGGPMQ~~*FM9uA&PFF FF~u VEP#ǃM Q}e[^_]ÍvU WVS}MQEPMAPƃ 6^ {t#C9u G vP2CC {tucMQMAx(uF v&FPM QSjW_{t6SB CR{u苇t69u@@uC{u SEPƃ&MAPVMAPbe[^_]UVS]u Ct%{u{uC t PS%t(Ft"~u~uF t PwVe[^]Ðt&UWVS}] uW+jShVhW}tjhEPhWhjEPhWTe[^_]ÐUE=u1]Ít&&8ut(! t("]ÐUWVSE u}tKjPjSsu PjSL |=jS=t>jV覦jS$uPjS }t( 6&1e[^_]Ít&UWVSE }utKjPEjSu PjS |=jSt>jWjStuPjS\}t(6&UJ1e[^_]ÍvUWVSE u]}jP耥SVP t(e[^_]Í&UWVSE u]}jP0SVPp t(e[^_]Í&UWVS]}1tC9u1jSݤSE脤 E=L t vtP}5t(t>jW蜤WEC E=L t vtP\} u5t(e[^_]Ív&UWVSE U}u]tjPu #t&jRVWPE t(e[^_]Í6UWVS] S = umS> 1ۃ9^ ~EUU16FPhURURURFPjaC9^ Ń~ ~FPfF e[^_]Í&UWVS1Eut%jPËPâS}=t(Ft*jPËFP薢S} u=t(~t)FPF P`FtLP\A&FtjjPhh 1PFPF PU RlaE~ t FP_VVt Ee[^_]ÍvUWVSUPRMQZà t`؃t, tDt&t+96&I6&96&)6&hf1 VM QMQܮ tϋMQSPV}2}tjMQkPh*M Qh.MQ{jjQQh>M쉍 QjQƃ j1tP1tP Qh EÃuL}t,jMQkjPh* QhEMQMV$QPvtWjjS }F}t,jMQjPh* Qh_MQSj a&؍[^_]ÐUWVS}11t"URh>EPjURÞƃt"U Rh>EPjU R虞ÃEPSV u$}ujSVEPh  &1e[^_]Ít&UWVS]ujNjUU WUW_ wG}tjU%v&} t jU v}tjURϞ v&1Ph>]SWU RURSh +à uW؍e[^_]U4WVSUE~,jhPhM Q$v&uPhM Ppvj@PM Qà uPS*= u=Sj1ۃ9_ ~+u̍vGPhVVM QLC9_ 1e[^_]Í&USE] MUu &RQSPd]]Í&UWVS}U t1t(Vj RxE u!jGPjSPjSMtC&&Mu(u't( M v&'1e[^_]ÐUWVS] }jS膜WSURt=t&&jURURVht(ht &1e[^_]Ít&UWVS] }jSWSURujURURVj t(e[^_]Í&UWVS1UZjS誛ScURSCWu}5t(e[^_]Í&UWVSEuDž\1j@PGX} t0} Ѝxt-U zpWhRF \PEPXR uhVV EPPVjjEPTtPV&EPoPV fE%Ph`SHSVVxt-U zsWhRW \PEPXR uhV#V EPPV jjEPetPV&EPPV fE%Ph`SXSVu Vu1 jbL[^_]Í&U(WVSE U]}PREP  utWSEP jjjƃ jjV8hV%OEE}tNEjEPjjV?jEPVE܃ jdV,E܃6&ut-EjEPjjVjEPVE܃ |e} t%jVPjVyE܃6&E}|-jEPVE܃ }=t(suEE}}@}t jMQ_aPhMQMtvVWn&j}tjVJC6vt V }tjMQ`PhMQ1e[^_]ÍvUWVS}u ]jjWf ؆fGuEJ&VREu2VAÃut(q1 6CMC PRQUEGe[^_]Ð&UWVS}u ]MUEPRQjSVWƃtgFF jFPPh]SVFPPSh vÃ(hhSW tt&Sj1e[^_]ÍUWVS]jS蜔jƉ~FF Sh]SYVWWSh Ã,hhSjt Sj81e[^_]ÍUWVSMU E]}jjjjPRQƃtO^~ Vh jFPh\jFP轔Ph]S$VjjSh + 6&1e[^_]Ít&U0WVSEEEEPEPjUԋBPTPCEЃ jURBǃj~FF URh]SVWWSh uÃ$uVURWwYt&hhSju SjUԃzt&fE%PEPuPSUԋB PBЍe[^_]Í6UWVSE111tL tt{jjjm u =t( 16jjj= u =t( L jjj u =t( tlvhFSVVh1hSjtWh6Sjt t&SjH1e[^_]ÍUS]jSPS赑]]Í&&UWVSu }EPVMQà tEu,jhAEujh_&&S= t= t= ubtPSjPU}t{RP5ujh]Vh$&M1"&jhVh]MQʼe[^_]ÐUWVS} u]VWS` u =t(te[^_]Í&U tP ]U塴 tPv ]UVS]u tPN Vt,tjSYPhVhSۻt&1e[^]Ðt&UWS}= = u jh bhS:u;t.=t("ujWHYPh W91,t&0P SP [_]Í&USUE hPRBà u1jjSnjS]]Í&UVSuEPV軎Ã}t hB fvu 1t&SrVVV,؍e[^]ÐUWVSU}uEPRTÃ}t hf ~VWSle[^_]Ív&UWVSU}uEPRÃ}t h ~VWS,e[^_]Ív&UWVSU} uEPR贍Ã}t h _~VWSe[^_]Ív&UWVS}t!0}Ѝp t&&1]ShBSStUtQjWÃ6VURSU u%=t(tSW蠌1jjSe[^_]Ív&UWVS,P( tP u>tv;/C;uh Ãu ;g,6p(DB t CDB uހ>:t 6;tC;:ujW9t%)PVW誾 {/tjh W蔾 jMQW腾j,POtC;r,\uF>u1FUUMUR}ux .tMQX SӲt̋URW¼jSW艻uPMQV롐EPRjڽ ufEf%f=@yjh W ]uEÍփ@B~ Cv+M T+UXy@BXI TT|3=Xut&hTjjjjLUR랍e[^_]ÐUjj\jjSjjJjjA jj5jj,jj #jj jj jjjj jj jjjj޻jjջjj̻ jj]Ít&UWVS}E 11t+ t<6t+36&#6&6&uPLt VP^ǃt5jW 9tSP'u1vjjSn t&S¿e[^_]Ít&&UWVSDž\,PDžTDžXDž`M<DžLu9L'v,S茷SLuPMQ蕐DDž@LHM9}6vHM:|uBt<&uztRHu9H|͋Huu9t:\P`Pu)t&&Dž@볍t&M \TPXPT茼Å*j U RhB URF!URV辱Uuu0}ЃP蘭_UR_S覫WVUu-hW W舯SVaUuWVNUWURV3Uur0}ЃP _UR_SWVUu-hW WSVְUuWVðUWU1 [^_]Í&&U1]ÐU WVS} MA]C6& .6& 6& 6& 6& 6&]Sp(DPt-ڃEjjPR‹u)&&x6&A< t< t +u~6&\l&‹p(]DCtKA]Ë]DCt:UŠIDCt t7e[^_]Ð&UWVS}t }]5p(KDF u\uy u9lACܐ&<"u*j"CP_Ã;Dd <{uT}}C;\u6}WSn];\t<}u Nv&<{t u FuC6 [u!jCPÃ;ۍ\u+{ EPS] $uS%Ã;tn뎍6&;u}i}[vѡp(DP u]u} u;B} +C&&Ce[^_]ÍvUVSu ]q\uEPS1]Z6&[u+6&jjSà ;t9C;]u$t&$t u vS*Ã;t C9uCe[^]Ív&UVSuN^{u N~}t 9tA9}u8t&Aӡp(DP u_t9(uF9t j)APAe[^]Ít&UVS]u Ev‹ p(DA t6 uECDA u;#uF}t@;\u+{ u{t_EPS]&Ct< u닍vEPVSà ;t6Cu&;eC#&Ct&&;]?؍e[^]ÍUE8t%jP8%]Í&&]ÐUSP%=P%tЃ;u]]É'U]Ð蛮/STotal aliases handled: %ldTotal bytes allocated to aliases: %ldVar command hits/misses/passes [%ld/%ld/%ld]Cmd command hits/misses/passes [%ld/%ld/%ld]You must specify an alias to be removed.Unmatched brace in %sJunk [%s] after closing brace in %salias.c(alias|assign) Missing Stub typeALIASASSIGN[%s] is an Unrecognized stub typeMissing alias nameMissing file namedumpFI~/%s.dumpwSaved to ~/%s.dumpBVALIOCHLOTIALLVAR cache [%d]: [%s] [%s]VAR cache [%d]: emptyCMD cache [%d]: [%s] [%s]CMD cache [%d]: emptyASSIGN names may not contain '%c'FUNCTION_RETURNAssign %s added [%s]LOCAL names may not contain '%c' (You asked for [%s])Assign %s (local) added [%s]Alias %s added [%s]ASSIGN names may not contain '%c' (You asked for [%s])You may not stub the FUNCTION_RETURN variable.Assign %s stubbed to file %s::LOADLooking for [%s] in level [%d]I found [%s] in level [%d] (%s)I didnt find [%s], stopped at level [%d]Assign %s removedNo such assign: %sAlias %s removedNo such alias: %sVisible Local Assigns: %*.*s %s STUBBED TO %s %s %sAssigns:Aliases:.STUB ASSIGN %s %s ALIAS %s %s Call stack[%3d] %sEnd of call stackCall stack [%3d] %s End of call stack !=<>&^|#+/%,-* expr.cInvalid assignment: No lvalueDivision by zero!%fInvalid assignment: no lvalueUnmatched %cExpanded [%s] to [%s]Missing %cASALGSM*aliasctl: MATCH isnt supported on that yet. Ask me to support it.aliasctl: Error%s stack is empty!%s is not on the %s stack!%s STACK LIST %s Unknown STACK type ??alist.carray.cERROR in find_index()banlist.c%sMODE %s %s%s %s KICK %s %s :%s +- MODE %s %s %s b*!*@*%c*<BX-LK> %sSent the Server all the Lamer Kicks, Sit back and Watch!*!*%s@%s*!*@%s*!*@*%s*!%s@%s%s!*%s@%s%s!%sUsing WhoWas info for unban of %s No match for the unban of %s on %s%s!%s@%sNo match for Unban of %s on %s-o+b+bFUCKBKIUsing WhoWas info for ban of %s FuckBanNo match for the %s of %s on %sTry to kick yourself again!!MODE %s %s %s%s!*%s@%s %s 3 Auto-Shit*multikickKICK %s %s :%smdvoice*!*@*-allvomassdeopNo matches for %s of %s on %sunvoicedevoicemassopmasskick%s!*%sopz/non-opznon-opzPerforming (%s) MaSS KicKs on %sKICK %s %s :%s No matches for masskick of %s on %s* KICK %s %s :(non-users) %sNo matches for masskick of non-users on %s*!*@!KICK %s %s :(%s) %sMODE %s +b %sNo matches for masskickban of %s on %s*!*%s@%s Performing Mass Bans on %sMODE %s +%s %sNo matches for massban of %s on %s*@*MODE %s -b %sMODE %s -%s %sNo ban matching %s foundkickKICK %s %s :%sKickBanMODE %s -o+b %s %s%s %s %sban%s %sNo bans on %sSecondsSetByChannel#%s %s %s %s %s%d %s %s %s %lu%d %s %s %s %lMODE %s bWhich ban to delete (-2, 2-5, ...) ? BanTypeUserScrewDomainHostBetterNormalBanType set to %ssend command to all on linkxlinkfind out who is on the botnet. globalwhomfind out who is on [option botnick]whoset a tcl variabletclsay something on a channelsayremove from chat networkquitsend msg to someonemsginvite to the chat networkinvitehelp information [option cmd]helpturn echo on/offechosend a privmsg to someone on botnetcmsgadd you to the chat networkchatboot user off the botnetbootPerform action on a channelactclink_comprivmsgprivjoinpartchanzapf-broadzapf%schan %s %d %s@%s %s [%s@%s] %s bot_link.cNo Active bot link%s %s %s%K(%R$1%K(%rxlink%K))%n $2-Csaycwhomwhom %d:%s@%s %s %d We don't like you[nick] Cboot.boot %s %s %s X-link commands toggled %s[nick] Cmsg.cmsg %s %s No information for %s foundAttempting Clink to %s!%s@%sAttempting clink with %s!%snick Clink[%s@%s] %s chan %s %d %s %s %s %s u@h%s %s %s %s%K[%RxLink%Y$1%K(%r$2%K)] %n$3-zapf %s %s %s zapf-broad %s %s %s join %s %s %d [%s@%s] has entered the TwilightZone entered the TwilightZonepart %s %s [%s@%s] has left the TwilightZone left the TwilightZoneHostBotWhopriv %s %s %-10s %-10s %-25s priv %s %s %-10s %-10s %-25s %s@%swho %s %s %s whom %s %s %s %s %-10s %-10s %-10s %-10s No Clients connected ConnectedBots%-10s %-15s %-10s %10s No Bots connected who %d:%s@%s %s %d Not found %s %-10s %-10s %-25s Unknown%-10s %-10s %-25s %s You have been booted by %s for %s %s has booted %s out of the TwilightZone for (%s) boot %s %s %s [%s] %s privmsg %s %s %s privmsg %s %s@%s %s You have been booted by %s for (%s) %s booting %s out of the TwilightZone (%s) Error in cmd_boot Can't boot a bot * %s %s dCC commands : %4d %-10s mSG commands : %4d %-10s %4d %-10s %s %4d %10s %s No such command [%s] PRIVMSG %s :%s Tcl: %s Tcl Error: %s Welcome to the TwilightZone GoodBye %s. No such for user %s NOTICE %s :You've been invited to a TwilightZoneNOTICE %s :Please type .chat in dcc chat to startInviting %s to TwilightZone %d %soff echo is now %s clink_com %s .xlink %s adds a password to a packSECUREdisplay cdcc statisticsSTATStoggle echo on/offECHOtoggle between public and noticeTYPEadd note to pack numberNOTEpublic list timer in minutesTIMERmirc resumeRESUMEtdcc resend a pack to userTRESENDtdcc send a pack to userTSENDre-send a pack to userRESENDsend a pack to userSENDsave your offerlist to .cdcc.save or specified nameSAVEview entries in the send queueQUEUEpublicly list your offered packsPLISTadd a pack to the offer listOFFERnotify the channel of offered packsNOTICEminspeed for cdcc ( #.##)MINSPEEDload packs saved to .cdcc.save or specified nameLOADlist the packs you have offeredLISTremove pack from the offer listDOFFERchange description of packDESCRIBEpublic timer channelCHANNELqueue status for usinfo on pack #NINFOlist of offered packshave CDCC tsend pack #Nhave CDCC tresend pack #Nhave CDCC send pack #Nhave CDCC resume pack #Nhave CDCC resend pack #Nhelp on CDCC commandsHELP%s: unknown command %scdcc.cDCC*NOTICE %s :try /ctcp %s cdcc helpNOTICE %s :%d file%s %d gets %ld size %2.4f minspeedNOTICE %s :Invalid info request,NOTICE %s :You have %d packs queued at %sNOTICE %s :You have no packs queued.tsend <#|filename>cdcctresend <#|filename>send <#|filename>resend <#|filename>resume <#|filename>%s: all dcc and queue slots full%s: Queued %d filesunknown%s %s %s %d %d %d %s %ssendingresending%s: %s %s%s%s pack #%d (%d file%s)%s %s%s: No such pack numberNo PasswordInvalid Password%s: Attempted get of secure pack %d from %s failed. [%s]NOTICE %s :CDCC: Failed attempt to get secure pack %d%s: Queued %d files for %sNOTICE %s :CDCC: all slots full... Some requests ignored. Added to queue for %d requestsNOTICE %s :CDCC: all dcc and queue slots full... Try again laterresumingNOTICE %s :CDCC: invalid pack numberNOTICE %s :CDCC: all slots full... Added to the queue for %d requests%1.3gPRIVMSG%s %s %s %d %d %d %d %d %s %s %s %s %lu %sNOTICE %s :Files Offered: /ctcp %s CDCC send #N for pack NNOTICE %s : [%d pack%s %d/%d slots open]NOTICE %s : [%d pack%s]%4.1fmb%4.1fkb%s %s %d %d %lu %d %sno descriptionNOTICE %s :#%d (%10s:%4d get%s) %-40.40s%s %s %sNOTICE %s : %sv@NOTICE %s :CDCC: %-6s - %s%s NOTICE %s :CDCC: %s%s: you have no packs offeredRemove pack [* for all packs]: #%-2d %-2d %-2d %s# files size gets minspeed description%s%4.1fEbTbGbMbKbbytes%-2d %3d %6s%-4s %4d 0.0 %-39.39svCpBA0A@Add file(s) to pack%s #%d : are not on a channel!have no packs offered!%s: you %s[cdcc] %d file%s offered- /ctcp %s cdcc send #x for pack #x[cdcc] dcc block size: %d, slots open: %2d/%2d, dcc queue: %2d/%2d%3.2fmb%3.2fkb%% #%-2d (%10s:%4d get%s) %-39.39s %sD%s: %-9s - %s[cdcc] %d file%s offered- "/ctcp %s cdcc list" for pack list%s: there are no queue entries%s %s %d %d %s#%2d nick: %9s (%d file%s)%s: %d entries in the queueREMOVE%s: deleted %d of %d entries from the queue%s: /Cdcc queue remove #|nick /Cdcc queue list [nick].cdcc.save~/%sw%s: couldn't open "%s"%s %s %d %d %ld 0.00 %d %s %s: %d pack%s saved to %srt%s: not a cdcc pack aborting%s: %d pack%s loaded~%s: you cannot access dir %s%s/%s %s: no files found, aborting...Description of pack #%d : %s: added note to pack #%d %s%s: added pack #%d, %d file%s (%s)Notes for pack #%d : @%s: No pack specified for removal%s: removed all packs from offer list%s: invalid pack specification%s: removed pack %d from offer list%s: pack %s does not exist%s: ERROR occured in cdcc add to queueNOTICE %s :CDCC: You're already Queued for %s at position %d%s: Already queued %d files for %s at %d%s: Queue position %d queuing %d files for %s%s: sending %s %d file%s from queue%s: Minspeed value to %1.4g KB/s%s: Make sure and /set _CDCC_MINSPEED_TIME as well%s min-speed (0 to disable): %s: Ptimer interval %d minutes%s p-timer interval(s) (0 to disable): %s: Public timer channel(s) are [%s]%s: Disabled %s public timer channel(s)%s: Public timer channel is [%s]%s: Disabled %s public timer channel%s: Invalid pack number %ld%s note to add to pack %ld %s description to add to pack %ld %s add note to pack #: %s change description of pack #: Noticeprivmsg%s: type of output for offer set to [%s]%s: local echo set to [%s]%1.3f %G%K[%C cdcc stat %K]%G͸ %G %G%g%K[%Cp%ctimer %K]%g-%K[%Ct%cype %K]%gķ%K[%Ct%cotal %Cp%cacks%K]%g%K[%Cs%cent %K]%gķ[%Cq%cueue%K]%gķ%Gnotice%d %s %d %d %d %G%g %W$[-10]0 %g %W$[-10]1 %g %W$[-10]2 %g %W$[-8]3 %g %W$[-7]4 %g%G %G%gĽĽĽ%G %G CDCC channel current channel %G %W$[63]0-%G %g%K[%C %c %C %c %K]%g%K[%C %c %C %c %K]%gķ%K[%Ct%coggles%K]%gķ1 1 %s %s %g %C %n %W$[-6]0%n%R %g %C %n %W$[-6]1%n%R %g %Ct%nimer: %W$[-3]2%n %Ce%ncho: %W$[-3]3 %goff %g %C %n %W$[-6]0%n%R %g %C %n %W$[-6]1%n%R %g %Cm%ninspeed: %W$[-3]2%n %Cs%necure:%W$[-3]3 %g %gĽĽ%d%d %d %lu %d %s%s: Removed passwd from %ld%s password to add to pack %ld: %s change password of pack #: %d-%schelp.c%d-%s %d%s%s: Help on Topic: %s%s %sNo help on %s.%d-%s %d %sXTYPEXTRAXQUOTEXEVALXECHOXDEBUGWWWSETWORDLISTWINDOWWILNWILMWIIWhoisWIWhoWasWHOWASWhoLeftWHOLEFT%Y<%Cnick%G!%nuser%Y@%nhostname%Y>%n %R[%nreason%R]%n %Y*%n Requires irc operator status - Kills multiple clients matching the filter %Y<%Cnick%G!%nuser%Y@%nhostname%Y>%n with %R[%nreason%R]%nWhoKillWHOKILLWHOISWhoWHOWHILE- Shows which script would be loaded without loading itWHICHWALLOPSWALLMSGWALLCHOPSWALLWAITWVoiceVOICEVERSIONVersionVERUserShowUSERSHOWUSERSUSERLISTUSERINFOUSERUSAGEURLUPTIMEuPingUPINGUNWORDKICKUnvoiceUNVOICEUnUserUNUSER- Unsets a channel topicUNTOPICUNTILUnShitUNSHITUNSHIFT%Y<%Cnick%Y>%n - Unscrew %Y<%Cnick%Y>%nUNSCREW- Unloads loaded DLL'sUNLOADDLL- Unloads all loaded scriptsUNLOADUNLESS%Y<%nnick(s)%Y>%n - Remove nicks from you lame nick listUnLameNickUNLAMENICK- Removes channel key from current channelUNKEY%Y<%Cnick%Y>%n - Removes %Y<%Cnick%Y>%n's host from the ignore listUnIgHUNIGH%Y<%Cnick%Y>%n - UnIgnores %Y<%Cnick%Y>%nUnIgUNIG%Y<%Bchannel%Y>%n - Removes %Y<%Bchannel%Y>%n from idle listUnIdleUNIDLE%Y<%Cnick%G|%Bchannel%Y> - Remove %Y<%Cnick%G|%Bchannel%Y> from forward listNoForwardUNFORWARD- Removes a banned wordUnWordKickUNBANWORDUNBAN%Y<%Bchannel%Y>%n - Removes autojoin %Y<%Bchannel%Y>%n from listUnAjoinUNAJOIN%Y<%nmode%Y>%n - Sets %Y<%nmode%Y>%n on yourselfUMODE%R[%Cnick%R]%n - Removes ban on %R[%Cnick%R]%nUB- Shows users on current channelUTYPETraceServTRACESERVTraceKillTRACEKILL - Without a specified server it shows the current connections on local server - Arguments: -s -u -o trace for servers, users, ircopsTRACE- Various Client toggles which can be changeTOGGLE%Y<%Bchannel%Y>%n %R[%non%G|%noff%R]%n - [Un]Locks %Y<%Bchannel%Y>%n with the current topicTLockTLOCKTIMER- Shows time and date of current serverTIGNORETCL- Interactive channel ban deleteTBAN%Y<%ntext%Y>%n - Sets %Y<%ntext%Y>%n as topic on current channelTOPICTSWITCH- Display or Modify what messages you want to see from the serverSWATCH%R[%nnick|#channel%R]%n Show Client Version informationSvSVStubSTUBSTATSSTACK%Y<%nserver1%Y>%n %R[%nserver2%R]%n %Y*%n Requires irc operator status - Disconnects %Y<%nserver1%Y>%n from current server or %R[%nserver2%R]%nSQUITSQUERY%Y<%nserver%Y>%n - Checks how lagged it is to %Y<%nserver%Y>%nSpingSPINGSLEEP- Shows the internal banned word listSHOWWORDKICK- Shows split serversSHOWSPLIT- Show the mode lock on the channelShowLockSHOWLOCK%R[%Bchannel%R]%n - Shows idle people on current channel or %R[%Bchannel%R]%nSHOWIDLESHOOK- Displays internal shitlistSHITLISTSHIFTSETENV%Y<%n-|d|pat1 pat2 ..%Y>%n - Adds or removes from your auto-responseSETAR- Set VariablesSET- Unknown server commandSERVLIST%Y<%nserver%Y>%n - Changes to %Y<%nserver%Y>%nSERVERSENDLINESEND%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for voiceScanVSCANV%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for shitlisted nicksScanSSCANS%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for opsScanOSCANO%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for non-opsScanNSCANN%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for ircopsScanISCANI%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for friendsScanFSCANF%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for bots on your botlistScanBSCANB%R[%Bchannel%R]%n - Scans %R[%Bchannel%R]%n or current channel for all nicksscanSCANSC-%Y<%ntype%Y>%n [-c for cool -a for annoy -e for elite] - Says whatever you write in either cool, annoy or elite formatSAYSAVELIST- Saves ~/.bitchxrcSAVEIRC- Saves ~/.BitchX/BitchX.savSaveAllSAVERPINGRETURN%Y*%n Requires irc operator status - Restarts serverRESTART- Fixes flashed terminalsRESET%Y<%Cnick%G|%Bchannel%Y>%n %Y<%nrequest%Y>%n - Sends CTCP %Y<%nrequest%Y>%n to %Y<%Cnick%G|%Bchannel%Y>%nREQUEST%Y<%ncommand%Y>%n %Y<%ntimes%Y>%n - Repeats %Y<%ncommand%Y>%n %Y<%ntimes%Y>%nREPEAT- Removes logfileRemLogREMLOGRelWTRELWTRelWRELWRelTTRELTTRelTRELTRelSWTRELSWTRelSWRELSWRelSTTRELSTTRelSTRELSTRelSNTRELSNTRelSNRELSNRelSMTRELSMTRelSMRELSMRelSRELS- Reloads BitchX.savRELOADRelNTRELNTRelNRELNRelMTRELMTRelMRELMRelITRELITRelIRELIRelDTRELDTRelDRELDRelCTRELCTRelCRTRELCRTRelCRRELCRRelCRELCRelREL- Reinitializes window variablesREINITSTAT- Reinitializes internal variablesREINIT%Y*%n Requires irc operator status - Rehashs ircd.conf for new configurationREHASH%Y<%Cnick%G|%Bchannel%Y> - Redirects to %Y<%Cnick%G|%Bchannel%Y>REDIRECT- Reconnects you to current serverRECONNECT- Displays current away logReadLogREADLOG- Removes a key bindingRBIND%Y<%Cnick%Y>%n - Changes your nick to a random nick. If nick is specified is is used as a prefixRANDOMNICK%Y<%ntext%Y>%n - Sends text directly to the serverQUOTE- Quit BitchXQUEUEQUERY- Sends a action to a queryqmeQME%Y<%n-cmd cmdname%Y> <%Cnick%Y>%n - Starts a query to %Y<%Cnick%Y>%nQPUSH - Removes all traces of variable(s) specifiedPURGE- Displays process tablepsPSPRETENDPOPPINGPAUSE- Leaves all channelsPARTALL- Leaves %Y<%nchannel%Y>%nPARSEKEY%Y<%nnick%Y>%n - Pings %Y<%nnick%Y>PingP%R[%non|off%R]%n %R[%-hide|+hide|hide%R]%n - turns on/off oper view window as well as creating hidden windowOV-Displays some internal statistics gathered about the serverOSTAT%Y<%Cnick%Y>%n - Attempts to regain a nick that someone else has taken from you.OrigNickORIGNICK%Y*%n Requires irc operator status %Y<%Cnick%Y>%n %R[%npassword%R]%nOPER%Y<%Cnick%Y>%n - Gives %Y<%Cnick%Y>%n +oOP%Y<%Cnick%Y>%n - Sends a oops message to last recipient of a message and sends the correct message to %Y<%Cnick%Y>%nOOPSONOffersOFFERS- Displays internal whowas info for all channels. This information expires after 20 minutes for users on internal list, 10 minutes for othersNWHOWAS%Y<%Cnick|channel%Y>%n - Shows internal statistics for %Y<%Cnick%Y>%nNWHOIS%Y<%nhostname%Y>%n - Returns the IP adress and IP number for %Y<%nhostname%Y>%nNSLOOKUP%Y<%Cnick|+|-nick%Y>%n - Adds/displays/removes %Y<%Cnick%Y>%n to notify listNOTIFY%Y<%Cnick%G|%Bchannel%Y> %Y<%ntext%Y>%n - Sends a notice to %Y<%Cnick%G|%Bchannel%Y> with %Y<%ntext%Y>%nNOTICENOTE%R[%Bchannel%R]%n - Shows, in a full format, all the nicks without ops in %R[%Bchannel%R]%n or channelNopsNOPS%Y<%nnick%Y>%n - Kills chat reqest from %Y<%nnick%Y>NoChatNOCHAT-Changes nick to specified nicknameNICKNEWUSERNEWNICK%R[%Bchannel%R]%n - Shows names on current channel or %R[%Bchannel%R]%nNAMESN%R[%Cnick%G|%Bchannel%G|%Cnick%Y!%Cuser%Y@%nhostname%Y]%n - Mass voice nicks matching %R[%Cnick%G|%Bchannel%G|%Cnick%Y!%Cuser%Y@%nhostname%Y]%nMVoiceMVOICE%Y<%nnick(s)%Y>%n %R[%nreason%R]%n - Kicks all %Y<%nnick(s)%Y>%n with %R[%nreason%R]MULT- Mass unbans current channelMUB%Y<%Cnick%Y>%n %Y<%ntext%Y>%n - Send %Y<%Cnick%Y>%n a message with %Y<%ntext%Y>%nMSGMSayMSAY%R[%nserver%R]%n - Shows MOTD on current server %R[%nserver%R]%nMOTD%R[%nfilename%R]%n - displays file in pagesMoreMORE- Mass ops everybody on current channelMOP%Y<%Bchannel%Y>%n +%G|%n-%Y<%ninstampkl #%Y>%n - Locks %Y<%Bchannel%Y>%n with +%G|%n-%Y<%nmodes%Y>%nModeLockMODELOCK- Mass kick bans non-userlist users on current channelMKNU- Mass kick bans current channelMKB- Mass kicks current channelMK - Turns mesg MESG - Sends an action to current channelME- Mass de-voices current channelMDVoiceMDVOICEMDOP- Mass deops current channelMD- Mass bans everybody on current channelMB- Displays a map of the current serversMAPSee %YMSG%nPRIVMSGM- Shows stats on current serverLUSERS- Displays list of filelsLS2LOCALfilename.tcl - Loads a tcl fileLOADTCLfilename.so - Loads filename as a dllLOADDLLfilename - Loads filename as a irc scriptLOAD%Y*%n Requires set %YLLOOK%n %RON%n - Lists all the servers which are current split from the IRC networkLLOOK%R[%Bchannel%R]%n - Leave the current channel, killing the window in current channel or%R[%Bchannel%R]%n as wellLkwLKW%R[%nreason%R]%n - Kicks all non +o people on current channel with %R[%nreason%R]%nLameKickLK- List currently loaded DLLsLISTDLL- Lists all channelsLIST- Shows servers and links to other serversLINKS%Y<%Bchannel%Y>%n - Leaves current channel or %Y<%Bchannel%Y>%nLEAVE-file filename%G|%n-clear%G|%n-max #%G|%n-liternal pat%G|%n-beep%G|%nlevelLASTLOG- Lists nicks in your lame nick listLAMENICKLIST- See %YLEAVEPARTL%Y<%Cnick%Y>%n %R[%nreason%R]%n %Y*%n Requires irc operator status - Kills %Y<%Cnick%Y>%n for %R[%nreason%R]%nKILL%Y<%Bchannel%Y>%n - Kicks all idle people on %Y<%Bchannel%Y>%nKICKIDLE%Y<%Bchannel%G|%Y*>%n %Y<%Cnick%Y>%n %R[%nreason%R]%nKICK%Y<%Cnick%Y>%n %R[%nreason%R]%n - Deops, kicks and bans %Y<%Cnick%Y>%n for %R[%nreason%R]%nKB%Y<%Cnick%Y>%n %R[%nreason%R]%n - Kicks %Y<%Cnick%Y>%n for %R[%nreason%R]%n on current channelK%Y<%nchannel%Y> %R[%nkey%R]%n %R[%n-hide%R]%n - Joins a %Y<%nchannel%Y>%n in a new windowJnwJNW%Y<%nchannel%Y> %R[%nkey%R]%n - Joins a %Y<%nchannel%Y>JISON - Changes your IRCUSERIRCNAMEIRCHOST%Y<%Cnick%Y>%n %R[%Bchannel%R]%n - Invites %Y<%Cnick%Y>%n to current channel or %R[%Bchannel%R]%nInput_CharINPUT_CHARInputINPUT- Shows current client infoINFO+%G|%n-%Y<%Cnick%Y>%n - Ignores ALL except crap and public of nick!host matching %Y<%Cnick%Y>%n and expires this on a timerIgtIGTIGNORE+%G|%n-%Y<%Cnick%Y>%n - Ignores ALL except crap and public of hostname matching %Y<%Cnick%Y>%n and expires this on a timerIgHtIGHT+%G|%n-%Y<%Cnick%Y>%n - Ignores ALL except crap and public of hostname matching %Y<%Cnick%Y>%nIgHIGH+%G|%n-%Y<%Cnick%Y>%n - Ignores ALL except crap and public of nick!host matching %Y<%Cnick%Y>%nIgIGIF- See %YINVITE%nINVITEI%Y<%nhostname%Y>%n - Shows list of possible hostnames with option to change it on virtual hostsHOSTNAME- Shows host of yourself or %R[%Cnick%R]%nUSERHOSTHOSTHOOK- Shows recently typed commandsHISTORYHELPServer commandHASHFUCKEMFuckFUCK%Y<%nhostname%Y> %R[%nlogin%R] [%npassword%R] [%n-p port%R]%n - Open a ftp connection to a hostFtpFTP- Setting various output formatsFsetFSET- Toggles flood protection to be either on or offFProtFPROT%Y<%nhostname%Y>%n %R[%Y<%nlowport%Y>%n %Y<%nhighport%Y>%R]%n - Attempts to find ports on %Y<%nhostname%Y>%n on %R[%Y<%nlowport%Y>%n %Y<%n %Y<%nhighport%Y>%R]%nFPORTS%Y<%Cnick%Y>%n - Forwards all messages to %Y<%Cnick%Y>%nForwardFORWARDFOREACHFOR- Flush ALL server outputFLUSH%Y<%Cnick%G!%nuser%Y@%nhostname%Y>%n%R[%nreason%R]%n Finds clients matching %Y<%Cnick%G!%nuser%Y@%nhostname%Y>%n and immediately kicks them from current channel for %R[%nreason%R]%nFK%Y<%Cnick%Y>%n - Fetches finger info on %Y<%Cnick%Y>%nFINGERFecFECFeFE- Quits IRCEXIT%Y<%ncommand%Y>%n - Executes %Y<%ncommand%Y>%n with the shell set from %PSHELL%nEXEC sends to server commandEVALSERVEREVALENCRYPT - Echos text to the screenECHO%Y<%ntype%Y>%n - Dumps %Y<%ntype%Y>%n to screen %Y<%ntype%Y>%n: %YAlias%n %YAll %n %YBind %n %YFile %n %YOn %n %YVar %nDumpDUMP- Displays some dcc file transfer statsDS- See deopDOPDO%Y<%nnick|hostname%y>%n - Attempts to nslookup on nick or hostnameDNS - Sends an action to current dccdmeDME- Disconnects you from the current serverDISCONNECT%Y*%n Requires irc operator status - Kills the IRC server you are onDIE- Show disk space usagedfDF%Y<%C%nnick(s)%Y>%n - de-voices %Y<%Cnick%y(%Cs%y)%Y>%nDeVoiceDEVOICE%Y<%Cnick%G|%Bchannel%Y>%n %Y<%naction%Y>%n - Describes to %Y<%Cnick%G|%Bchannel%Y>%n with %Y<%naction%Y>%nDESCRIBE%Y*%n Requires irc operator status - Removes irc operator statusDEOPER%Y<%C%nnick(s)%Y>%n - Deops %Y<%Cnick%y(%Cs%y)%Y>%nDEOPDEBUGUSERDEBUGMSGDEBUGHOOKDEBUGHASHDEBUGFUNC%R[%nflags%R]%n - Sets various debug flags in the clientDEBUG%Y<%nnick%Y>%n - Kills all dcc chats to %Y<%nnick%Y>DcxDCX%Y<%nnick%Y>%n - Kills all dcc sends to %Y<%nnick%Y>DcsDCS%Y<%nnick%Y>%n - Kills all dcc gets to %Y<%nnick%Y>DcgDCGDCCCRASHDisplays a active DCC list. For more info /dcc helpDCC- Kills all dcc connectionsDcaDCA%Y<%Cnick%Y>%n - Starts a DCC CHAT to %Y<%Cnick%Y>%nDC- Clears all bans on current channelDBAN- Shows current time and date from current serverTIMEDATESee %YDESCRIBE%nD%R[%Bchannel%R]%n - Leaves current channel or %R[%Bchannel%R]%n and immediately rejoinsCYCLECwhomCWHOM- Lists the clients and bots connected to the TwilightZoneCwhoCWHOCTOGGLE%Y<%Cnick%Y>%n %Y<%nrequest%Y>%n - CTCP sends %Y<%Cnick%Y>%n with %Y<%nrequest%Y>%nCTCP%R[%n*|channel|chan*%R]%n - changes variables that affect a channel or displays themCsetCSET%Y<%ntext%Y>%nCsayCSAYCONTINUE%Y<%nserver1%Y>%n %Y<%nport%Y>%n %R[%nserver2%R]%n %Y*%n Requires irc operator statusCONNECT%Y<%Cnick%Y>%n %Y<%ntext%Y>%n - While in the TwilightZone, a private message will be sent to %Y<%Cnick%Y>%n with %Y<%ntext%Y>%nCmsgCMSG%Y<%Cnick%Y>%n %Y<%ntext%Y>%nClinkCLINK- Clears the nicks in the tabkey listCLEARTAB%Y<%Cchannel%G|%Y*>%n - Unlocks the mode lock for %Y<%Cchannel%G|%Y*>%nClearLockCLEARLOCK- Clears all the nicks in the auto-response listCLEARAUTO- Clears the screenCLEAR%R[%Bchannel%R]%n - Shows, in a full format, all the nicks with op statusChopsCHOPS%Y<%Cnick%Y>%n %Y<%nuserhost%Y>%nChgUHCHGUHChgProtCHGPROT%Y<%Cnick%Y>%n %Y<%nprotection-level%Y>%nChgPassCHGPASS%Y<%Cnick%Y>%n %Y<%nlevel%Y>%nChgLevelCHGLEVEL%Y<%Cnick%Y>%n %Y<%Bchannel%Y>%nChgChanCHGCHAN%Y<%Cnick%Y>%n ChgAopCHGAOP%Y<%nNick%Y>%n - Attempts to dcc chat nickChatCHAT%Y<%n-ALL%Y> %R[%Bchannel%R]%n - Shows statistics on current channel or %R[%Bchannel%R]%nCHANST- Shows information on the channels, modes and server you are onJOINCHANNEL%Y<%ncommand%Y>%n - Channel, DOffer, Echo, Load, List, MinSpeed, Notice, Offer, PList, Queue, ReSend, Save, Type Describe NoteCDCC%Y<%ndir%Y>%n - Changes current directory to %Y<%ndir%Y>%n or prints current directoryCD%Y<%nnick%Y>%n %R[%nreason%R]%n - Kicks a %Y<%nnick%Y>%n off the TwilightZone with %R[%nreason%R]CbootCBOOTCALL%Y<%nnick|channel%Y> <%nmode%Y>%n - Sets a mode for a channel or nickMODEC- Quit IrcQUITBYEBREAKBLESS%Y<%Cnick%Y>%n %R[%nreason%R]%n - Deops, bans, kicks and ignores %Y<%Cnick%Y>%n for %R[%nreason%R]%nBkiBKI%Y<%Cnick%Y>%n %R[%nreason%R]%n - Deops, bans and kicks %Y<%Cnick%Y>%n for %R[%nreason%R]%nBK- Command to bind a key to a functionBIND%Y<%nhelp%W|%nindex%W|%nother%Y>%n - Externel help command for use with ~/.BitchX/BitchX.helpBHELP- Creates a beep noiseBEEP%Y<%nchannel|*%Y>%n word(s) - Adds word or words to the banned words list for %Y<%nchannel%Y>BANWORDS%W/%nbantype %Y<%nNormal%G|%nBetter%G|%nHost%G|%nDomain%G|%nScrew%Y>%n - When a ban is done on a nick, it uses %Y<%nbantype%Y>%nBANTYPE%R[%Bchannel%R]%n - Show bans on current channel or %R[%Bchannel%R]%nBANSTAT%Y<%Cnick%G|%Cnick%G!%nuser%y@%nhostname%Y>%n - Ban %Y<%Cnick%G|%Cnick%G!%nuser%y@%nhostname%Y>%n from current channelBAN- Sets you back from being awayBackBACKSee %YBAN%nB%R[%nALL|MSGS|NOTICES|...%R]%n - Displays or changes what you want logged in your lastlog. This is a comma separated listAwayLogAWAYLOG%R[%nreason%R]%n - Sets you away on server if %R[%nreason%R]%n else sets you backAwayAWAYASSIGNALIAS- Display list of ajoin channelsAJoinListAJOINLIST%Y<%Bchannel%y(%Bs%y)%Y>%n - Add %Y<%Bchannel%y(%Bs%y)%Y>%n to AJoin list%P;%n it joins %Y<%Bchannel%y(%Bs%y)%Y>%n on startup or change of serverAJoinAJOIN%R[%nserver%R]%n - Shows the iRC Administration information on current server or %R[%nserver%R]%nADMIN%Y<%Bchannel%G|%Y*>%n %Y<%nword%y(%ns%y)%Y>%n - Adds %Y<%nword%y(%ns%y)%Y>%n to wordlist, anyone saying it in %Y<%Bchannel%G|%Y*>%n will be kickedADDWORD%Y<%Cnick%G|%Cnick%G!%nuser%Y@%nhostname%Y>%n %Y<%Bchannel%G|%Y*>%n %R[%nuserlevel%R]%n %R[%nauto-op%R]%n %R[%nprotection%R]%n %R[%npassword%R]%n - Adds %Y<%Cnick%G|%Cnick%G!%nuser%Y@%nhostname%Y>%n on %Y<%Bchannel%G|%Y*>%n with %R[%nuserlevel%R]%n %R[%nauto-op%R]%n and %R[%nprotection%R]%n levels to your userlistAddUserADDUSER%Y<%Cnick%G|%Cnick%G!%nuser%Y@%nhostname%Y>%n %Y<%Bchannel%G|%Y*>%n %R[%nshitlevel%R]%n %R[%nreason%R]%n - Add %Y<%Cnick%G|%Cnick%G!%nuser%Y@%nhostname%Y>%n to your shitlist on %Y<%Bchannel%G|%Y*>%n with %R[%nshitlevel%R]%n and for %R[%nreason%R]%nAddShitADDSHIT%Y<%Cnick%Y>%n - Adds %Cnick%n to your no flood listAddNoFloodADDNOFLOOD%Y<%Cnick%G|%Cnick%C nick nick%Y>%n - Adds %Y<%Cnick%Y>%n to your lame nicklist, bans nick!*@*AddLameNickADDLAMENICK%Y<%Bchannel%Y>%n %R[%nseconds%R]%n - Adds %Y<%Bchannel%Y>%n as idle channel with %R[%nseconds%R]%nAddIdleADDIDLE%Y<%Bchannel%G|%Cnick%Y>%n - Forward all messages to %Y<%Bchannel%G|%Cnick%Y>%nAddForwardADDFORWARD- Shows yet another ansi screen with greets to people who have contributed to the %PBitchX%n projectABOUT- Saves IRCII settings then exits IRCABORT:%Y<%Cnick%Y>%n - Sets mode +oooo on %Y<%Cnick%Y>%n4OP#                                                                                          rE   ܲ  Grtz To: Trench, HappyCrappy, Yak, Zircon, Otiluke, Masonry, BuddahX, Hob,  Lifendel, JondalaR, JVaughn, suicide, NovaLogic, Jordy, BigHead,  Ananda, Hybrid, Reefa, BlackJac, GenX, MHacker, PSiLiCON,  hop, Sheik, psykotyk, oweff and bark0de!   Thanks to tyme.net for hosting BitchX.com No such nick %sdcftpcommands.c-Username has been changed to '%s'IrcUserRealname at next server connnection: %sRealNameNOFORWARDNo longer forwarding messages to %sNOTICE %s :%s is no longer forwarding to youNOTICE %s :%s is now forwarding messages to youNow forwarding messages to %sAJoin List%10s %sEnd of AJoin ListRemoving Auto-Join channel %s%sAuto-Joining %s%s%sJOIN %s %sPRIVMSG %s :Oops, that /msg wasn't for youPRIVMSG %s :%s%s %s%s %s %s %sTry connecting to a server first.Reconnecting to server%s %d$G Reconnecting to server %K[%W$1%K]+%iReconnectingAclear INVITE %s %s%s%sinviteoh_my_wait%s %s %sPART %sMODE %s -k %sMODE %s +k (BMODE %s -k (BMODE %s +oooo %s %s %s %sscanvscanoscannscanfscansscani%s %s %d %s%c %s%s%sNAMES %sWHOIS %sNobody has messaged you yetNobody has noticed you yetWHOIS %s %suPING*%s PING %ld %ld%s ECHO %ld %ld%s PING %ld*** You may not use the CTCP command in an ON CTCP_REPLY!XDCC LISTCDCC LISTYou may not use the CTCP command from an ON CTCP_REPLY!CtcpHookMODE %s -oDoing this is not a good idea. Add -YES if you really mean itMAMIPUPRY%s >%d,<%d%s >%d%s <%d-cfor-cmdwait %procUnknown argument to /WAITMust be on a channel to redirect to '*'You may not redirect output to yourselfNo active DCC CHAT:chat connection for %sredirectsleep%s: -LINE only works if -WIN is specified first%s: -LINE only works on scratch windows%s: -LINE %d is out of range for window (max %d)OPER %s %sOperator Password:wIRCII settings saved to %sError opening %s: %sirc.abortedyALIASOSALLsaveUnknown userReally write %s? -iYou have not been invited to a channel!Channel %s is bound to another windowYou are now talking to channel %s%s %s%s%sYour nickname is %sA nickname change to %s is pending.Nickname specified is illegal.Client: %s (internal version %s)Local host name is now %s/sbin:/usr/sbin:/bin:/usr/binifconfigCan't find ifconfig%s -a >%srLooking for hostnames on device eth0inet addr127.0.0.1$G Current hostnames available%d %s%K[%W$[3]0%K] %B$1Local host name is now [%s]%s Currently online: %sUsage: SETENV userhostWHOWAS %solchoheasnanifWHO %sNo arguements specified*.*%s %s %cYou were /away for %i hours %i minutes and %i seconds. [BX-MsgLog %s]%s %d %d %d %d %sPRIVMSG %s :ACTION %s read /away msgs (%d msg%s) log [Y/n]? %s@%sExcelllaaant!!Active DCC's. Really Quit [y/N] ? Standby, Flushing server output...Done%s :%s!! %s.You have not sent a message to anyone yet,You have not received a message from anyone yetTracing server %s%sfor OperatorsTracing server %s%sfor UsersTracing server %s%sfor servers%s%s%s%GType Host Nick%GType Class PingF ConnF MaxLi SendQ%GType Host Host Port Class%GType Server Mask Server Name%Glinknick|server sendq smsgs sbytes rmsgs rbytes timeopen%GType Host UserName ReasonTOPIC %s :%s %s :%s %s%s %s :%s%s%s%s %s :%s%s/BitchX.killkick%s %s %s :%s%s * is not valid since you are not on a channel*%s*> %s%s> %s-%s-> %sZ v\ v#[|p*[|p*Invalid process specificationNo DCC CHAT connection open to %smsgYou cannot send a message from within ON NOTICENOTICE %s :-> *%s* %sWALLOWALLCNo server for this window/$%s%s %s%s%s%s %sCommands:$G $[15]0 $[15]1 $[15]2 $[15]3DLL Commands:Aliases:Functions:Unmatched { Executing [%d] %sUnknown command:%s: command disabled%s: You are not connected to a server. Use /SERVER to connect.Ambiguous command: %sRight before line [%d] of file [%s]Loaded right before line [%d] of file [%s]LOAD_PATH has not been setNo more than %d levels of LOADs allowed-argsUnknown user for file %s{};/; {{Unexpected } in %s, line %d}File %s ended with an unterminated comment in line %dUnexpected EOF in %s trying to match '{' at line %dCD: %sCD No such dirCurrent directory: %sdescribe&#meUsage: %s "prompt" { commands }Unknown flag -%s to XTYPEe_pauseTcl: [%s]loadtclCannot BREAK here.Cannot CONTINUE here.Cannot RETURN here.FUNCTION_RETURNNo such command [%s]No Help available$G Found %K[%W$0%K]%n matches for %K[%W$1%K]$G $[13]0 $[13]1 $[13]2 $[13]3 $[13]4%R[%ncommand%R]%n to get help on specific commandshelpNo Channel or no servercommands2.cNick%s%G$[7]0 @ v UL: l a p SL: l +o -o +b -b kicks nicks pub%s %c %c %d %d %d %d %d %d %d %d %d %d %d$[10]0 %C$1 $2%w %B$[3]3 $[2]4 $[2]5 %R$[6]6 %M$[4]7 $[4]8 $[4]9 $[4]10$[-4]11 $[-4]12 $[-6]13All%d %s$G End /NWhoIs list for $1- [Mem Usage: $0 bytes per chan]$G No such nick or channeltcpUNKNOWNHostname %s:%s port %d is running (%s)Scanning %s's tcp ports %d through %dNo such host %sFPORTBanWordsAdded %s to %s Banned Word List[%s] is already in the list for channel %sRemoved %s Banned Word [%s]Banned Word %s not found.Banned Word(s)Channel%14s %40s%-14s %40sNo Banned Words on list# %s Banned Words BANWORD %s %s BanWords %dSaved %d Banned Words List-k +k +l -l+-MODE %s %sModeLockNo Mode SpecifiedUsers%s Mode Locked at: [%s] %sInvalid Mode for [%s]No Such ChannelClearLockCleared %s Mode LockNo such Channel [%s]Cleared All Channel Mode LocksnoneLock on %s: %sNICK %s%sONOFTopic lock for [%s] - %s*.*Sent server ping to [%s]PING LAG%ld.%ld :%sPING %s :%sOFFToggled flood protection - [%s]%G---%g%G-%K[ %WBitchX %wToggles %K]-%g%G-%g---%K%g--%K%g-%K--- -- - --- -- -%s %s %s%G %Cauto_ns%clookup %K[%W$[-3]0%K] %Cctcp_f%clood_protection %K[%W$[-3]1%K] %Cbeep%c %K[%W$[-3]2%K]%G %Cpub%cflood %K[%W$[-3]0%K] %Cflood_p%crotection %K[%W$[-3]1%K] %Ckickf%clood %K[%W$[-3]2%K]%g %Cdcc_a%cutoget %K[%W$[-3]0%K] %Cflood_k%cick %K[%W$[-3]1%K] %Cmsg%clog %K[%W$[-3]2%K]%G %Cll%cook %K[%W$[-3]0%K] %Cdeop%cflood %K[%W$[-3]1%K] %Cjoin%cflood %K[%W$[-3]2%K]%g| %Cauto_w%chowas %K[%W$[-3]0%K] %Cverb%cose_ctcp %K[%W$[-3]1%K] %Cnickfl%cood %K[%W$[-3]2%K]%G: %Ccl%coak %K[%W$[-3]0%K] %Coper%cview %K[%W$[-3]1%K] %Cshit%clist %K[%W$[-3]2%K]%G: %Ckick_o%cps %K[%W$[-3]0%K] %Cannoy%c_kick %K[%W$[-3]1%K] %Cuser%clist %K[%W$[-3]2%K]%K| %Chack%cing %K[%W$[-3]0%K] %Cnick_c%completion %K[%W$[-3]1%K] %Cauto_rej%coin %K[%W$[-3]2%K]%K: %Caop %K[%W$[-3]0%K] %Cauto_aw%cay %K[%W$[-3]1%K] %Cauto_rec%conn %K[%W$[-3]2%K]%K: %Cbitch %K[%W$[-3]0%K] %Cdcc_f%cast %K[%W$[-3]1%K] %Ckick_if_ban %K[%W$[-3]2%K]%g: %Cftp_g%crab %K[%W$[-3]0%K] %Cmircs %K[%W$[-3]1%K] %Chttp%c_grab %K[%W$[-3]2%K]%s %s%K: %Cdisp%clay_ansi %K[%W$[-3]0%K] %Wtype /toggle %Clog %K[%W$[-3]1%K]auto_nslookup%cToggled %GAuto-NSlookup %K[%W$[-3]0%K]pubflood%cToggled %GPub Flood %K[%W$[-3]0%K]dcc_autoget%cToggled %GDCC Auto Get %K[%W$[-3]0%K]llook%cToggled %GLink Look %K[%W$[-3]0%K]auto_whowas%cToggled %GAuto-WhoWas %K[%W$[-3]0%K]cloak%cToggled %GCloaking %K[%W$[-3]0%K]kick_ops%cToggled %GKick Ops %K[%W$[-3]0%K]ctcp_flood_protection%cToggled %GCtcp Flood Protection %K[%W$[-3]0%K]flood_protection%cToggled %GFlood Protection %K[%W$[-3]0%K]flood_kick%cToggled %GFlood Kicks %K[%W$[-3]0%K]deopflood%cToggled %GDeOp Flood %K[%W$[-3]0%K]verbose_ctcp%cToggled %GVerbose CTCP %K[%W$[-3]0%K]operview%cToggled %GOper View %K[%W$[-3]0%K]annoy_kick%cToggled %GAnnoy Kicks %K[%W$[-3]0%K]beep%cToggled %GBeep %K[%W$[-3]0%K]kickflood%cToggled %GKick Flood %K[%W$[-3]0%K]msglog%cToggled %GMSG log %K[%W$[-3]0%K]joinflood%cToggled %GJoin Flood %K[%W$[-3]0%K]nickflood%cToggled %GNick Flood %K[%W$[-3]0%K]shitlist%cToggled %GShitList %K[%W$[-3]0%K]userlist%cToggled %GUserList %K[%W$[-3]0%K]hacking%cToggled %GHacking %K[%W$[-3]0%K]auto_rejoin%cToggled %GAuto_Rejoin %K[%W$[-3]0%K]nick_completion%cToggled %GNick Completion %K[%W$[-3]0%K]aop%cToggled %GAOP %K[%W$[-3]0%K]auto_away%cToggled %GAuto Away %K[%W$[-3]0%K]auto_reconnect%cToggled %GAuto Reconnect %K[%W$[-3]0%K]mircs%cToggled %GmIRC Color %K[%W$[-3]0%K]bitch%cToggled %GBitch %K[%W$[-3]0%K]dcc_fast%cToggled %GDCC fast %K[%W$[-3]0%K]kick_if_banned%cToggled %GKick banned Users %K[%W$[-3]0%K]ftp_grab%cToggled %GFTP grab %K[%W$[-3]0%K]http_grab%cToggled %GHTTP grab %K[%W$[-3]0%K]display_ansi%cToggled %GAnsi Display %K[%W$[-3]0%K]log%cToggled %GLogging %K[%W$[-3]0%K]Unknown /toggle [%s]No Match for kill of [%s]*!%s@%sKilling %s!%s@%s[%s] %dKILL %s :%s (%d)%s %s %s %s %sPRIVMSGAlready doing %s*%s%s%sWHO %sNo Match for trace kill of [%s]Killing %s[%s] %dUser: %sAlready in %sTRACETRACE %s-hideJOIN %s%s%sRegained nick [%s]OrigNickNot trying to gain a nickRemoving gain nick [%s]Trying to regain nick [%s]Nickname was all bad charsThere are no nicks on your lame nick listLame Nick list: %s addlamenicktofromAddedRemoved%s %s LameNick listHTTP:FTP:%s %s -- %sAdded HTTP/FTP grab [%d]SAVE%s/BitchX.urla%s HTTPFTPCLEARLIST$G HTTP[$0] $1-$G HTTP grab %K[%W$0%K]%n FTP grab %K[%W$1%K]%G---%g%G-%K[ %WServer %wStats %K]-%g%G-%g---%K%g--%K%g-%K--- -- - --- -- -%l %l%G %CN%cick Collisions %K[%W$[-4]0%K] %CO%cper Kills %K[%W$[-4]1%K]%G %CF%cake Modes %K[%W$[-4]0%K] %CU%cnauth %K[%W$[-4]1%K]%g %CH%cigh Traffic %K[%W$[-4]0%K] %CN%corm Traffic %K[%W$[-4]1%K]%G %CT%cotal Clients %K[%W$[-4]0%K] %CS%cerv rehash %K[%W$[-4]1%K]%g| %CC%client exits %K[%W$[-4]0%K] %CK%c-lines adds %K[%W$[-4]1%K]%G: %CC%client Floods %K[%W$[-4]0%K] %CS%ctats reqs %K[%W$[-4]1%K]%G: %CI%cnvalid User %K[%W$[-4]0%K] %CO%cper Reqs %K[%W$[-4]1%K]%K| %CP%cossible Bots %K[%W$[-4]0%K] %CB%cot Alarms %K[%W$[-4]1%K]%g: %CS%cerv Squits %K[%W$[-4]0%K] %CS%cerv Connect %K[%W$[-4]1%K]_^\{}[]|-_^\{}[]|-0123456789SetARAuto-reply pats are deletedAuto-Response now set to [%s]No Flood listcrypt.c%s added to the crypt with key %sNo such nickname in the crypt: %s%s removed from the cryptThe crypt:%s with key %sThe crypt is empty%cSED my uptimeUPTIMEftp file sendXMITx-filez ruleXLINKchange userhost of userlistIDENTunbans the person from channelUNBANOPSops the person if on userlistOPuser list informationWHOAMIinvite to channel specifiedINVITEECHOreturns the arguments it receivesPINGtells you the time on the user's hostTIMEshows real name, login name and idle time of userFINGERreturns error messagesERRMSGreturns user settable informationUSERINFOgives information about available CTCP commandsCLIENTINFOshows client type, version and environmentVERSIONXDCCBDCCchecks cdcc info for youCDCCrequests a direct_client_connectionDCCcontains action descriptions for atmosphereACTIONsubstitutes the local timezoneUTCcontains simple_encrypted_dataSEDNOTICEPRIVMSG%s %s %s %s %s %s%s! Access Denied from %s %s %s [%s]IDENT *ctcp.c*%s@%sNOTICE %s :UserHost updated to %sSuccessful %s from %s!%sNOTICE %s :try /ctcp %s cdcc helpXLINK %s -p %s -e %s%s -e %sSuccessful %s from %s!%s to %s [%s]-nullInvalid Bot Link request %s %s %sInvite to NOTICE %s :Ctcp-inviting you to %s. Key is [%s]NOTICE %s :Ctcp-inviting you to %sINVITE %s %sSuccessful INVITE from %s!%s to %sNOTICE %s :%s: I'm not on %s, or I'm not oppedNOTICE %s :%s: I'm not on that channelNOTICE %s :%s: Access DeniedWhoAmINOTICE %s :%s: Userlevel - %s Password RequiredNOTICE %s :%s: Host Mask - %s Channels Allowed - %s %sSuccessful %s from %s!%s to %sUptimeNOTICE %s :%s: Current Uptime is %sOps onMODE %s +o %sMODE %s +v %sVOICEUnBan on %s!%sMODE %s -b %sSuccessful %s from %s!%s on %sNOTICE %s :%s: you %s are not banned on %s[ENCRYPTED MESSAGE]msg%s %s %s%s %s %s %s %snone%s %s%s: %s is not a valid function %s :Use CLIENTINFO to get more specific information/VER is lameKICK %s %s :%sunknown Keep it to yourself!%s :%sWARNING ctcp echo request longer than 60 chars. truncatingIRCUSERIRCFINGER%s (%s@%s) Idle %ld second%sREJECT%5.3f seconds.A%s %s %s %s%c%s %s%c%c%s%cUSERLISTSHITLISTPUBFLOOD_TIMEPUBFLOOD_IGNORE_TIMEPUBFLOODNICKFLOOD_TIMENICKFLOODLAMELISTKICK_ON_PUBFLOODKICK_ON_NICKFLOODKICK_ON_KICKFLOODKICK_ON_JOINFLOODKICK_ON_DEOPFLOODKICK_OPSKICK_IF_BANNEDKICKFLOOD_TIMEKICKFLOODJOINFLOOD_TIMEJOINFLOODHACKINGDEOP_ON_KICKFLOODDEOP_ON_DEOPFLOODDEOPFLOOD_TIMEDEOPFLOODCOMPRESS_MODESBITCHAUTO_REJOINAOPANNOY_KICKAINVSTATUS_WINDOWSTATUS_VOICESTATUS_USERSSTATUS_USER9STATUS_USER8STATUS_USER7STATUS_USER6STATUS_USER5STATUS_USER4STATUS_USER3STATUS_USER2STATUS_USER19STATUS_USER18STATUS_USER17STATUS_USER16STATUS_USER15STATUS_USER14STATUS_USER13STATUS_USER12STATUS_USER11STATUS_USER10STATUS_USER1STATUS_USERSTATUS_UMODESTATUS_TOPICSTATUS_SERVERSTATUS_SCROLLBACKSTATUS_QUERYSTATUS_OPER_KILLSSTATUS_NOTIFYSTATUS_NICKSTATUS_MSGCOUNTSTATUS_MODESTATUS_MAILSTATUS_LAGSTATUS_HOLD_LINESSTATUS_HOLDSTATUS_FORMAT3STATUS_FORMAT2STATUS_FORMAT1STATUS_FORMATSTATUS_FLAGSTATUS_DCCCOUNTSTATUS_CPU_SAVERSTATUS_CLOCKSTATUS_CHANOPSTATUS_CHANNELSTATUS_CDCCCOUNTSTATUS_AWAYValue must be either ON, OFF, or TOGGLE%s %s %s%sValue of %s must be numeric!Value of %s must be greater than 0%s %s %dCSET_VARIABLE: You have no channels to cset on!No such variable "%s"%s is ambiguouscset.c%s %sValue of %s set to %sWSET_type not supportedNo such window name [%s]helpHELP[+nick|+nick1,+nick2,...|nick|nick1,nick2,...] - Adds or removes nick(s) to the dcc exempt list which bypasses autogetEXEMPTXSENDexperimentalXRECV[hostname] [[user] [passwd] [-p port]] - Starts a ftp connection to hostnameFTP[on|off] - toggle overwrite of files on/offOVERWRITE[on|off] - toggles display of paths on/offPATHS - Displays dcc stats for this sessionSTATS[on|off] - toggle dcc quiet mode on/offQUIET[nick] - Sends text to a dcc raw connection to [nick]RAW[nick|nick1,nick2,...] [file] [-e password] - DCC resumes a file ala mirc. NOTE autoget must be offRESUME[nick] [description] [new description] - Renames an incoming dcc fileRENAME[#all|#|[send|get|resend|reget|nick #|#all|-all|filename][type]] - Closes a dcc connectionCLOSE[nick|nick1,nick2,...] [[filename][-e encrypt]] - TurboDCC regets from nick(s) filename using encrypt if suppliedTREGET[nick|nick1,nick2,...] [[filename][-e encrypt]] - DCC regets from nick(s) filename using encrypt if suppliedREGET[nick|nick1,nick2,...] [[filename][-e encrypt]] - TurboDCC gets from nick(s) filename using encrypt if suppliedTGET[nick|nick1,nick2,...] [[filename][-e encrypt]] - DCC gets from nick(s) filename using encrypt if suppliedGET[nick|nick1,nick2,...] [filename] [[-e encrypt][-p port]] - TurboDCC resends filename to nick(s) using encrypt and portTRESEND[nick|nick1,nick2,...] [filename] [[-e encrypt][-p port]] - DCC resends filename to nick(s) using encrypt and portRESEND[nick|nick1,nick2,...] [filename] [[-e encrypt][-p port]] - DCC sends filename to nick(s) using encrypt and portSEND[nick|nick1,nick2,...] [filename] [[-e encrypt][-p port]] - TurboDCC sends filename to nick(s) using encrypt and portTSEND - Lists dcc's in new formatGLIST - Lists dcc's in old formatLIST[nick] - Starts a dcc chat connectionCHAT[nick] - Starts a dcc bot connection with another bx clientBOT[on|off] - toggles auto-rename on/offAUTO_RENAME[on|off] - toggles auto-get on/offAUTO - Displays active dcc and limitACTIVEXMITRECVXMITSENDFTPSENDFTPGETRAW_LISTENdcc.cchat%s %s %s %du@h%s %s %s %s %s %d%s%l$G %RDCC %YTelling uplink we want to start at%n: $0user %s pass %s %gFTP%n command failed writetype i $G Unknown %RDCC%n command: $0Unknown Host$G %RDCC%n Unable to create connection: $0-%s %s %lu %u %lu%s %s %lu %u %s%s %s %lu %u%s %s %s%s@%s$G %RDCC%n You must supply a nickname for DCC chat$G %RDCC%n A previous DCC chat to $0 exists=msg%d %s$G %RDCC%n You must supply a nickname for DCC bot$G %RDCC%n A previous DCC Bot to $0 exists$G %RDCC%n Cannot bind to a privileged portraw_listen$G %RDCC%n A previous Raw Listen on $0 exists$G %RDCC%n socket() failed: $0-$G %RDCC%n Could not bind port: $0-$G %RDCC%n Unknown host: $0-%s %d$G %RDCC%n A previous DCC raw to $0 on $1 exists%s %s E %d%s RAW %s %d$G %RDCC%n Cannot send a directory/etc/$G %RDCC%n Send request for /etc rejected%s %s$G %RDCC%n A previous DCC send:$0 to $1 exists$G %RDCC%n You must supply a nickname and a filename for DCC resend$G %RDCC%n Unable to expand: $0%s/%s$G %RDCC%n Cannot access: $0$G %RDCC%n You must supply a nickname and a filename for DCC send/~$G %RDCC%n Cannot access directory: $0$G %RDCC%n Sent DCC SEND request to $0 for files $1$G %RDCC%n No Files found matching $0%s %s/%s$G %RDCC%n Attempting DCC get: $0$G %RDCC%n You must supply a nickname for DCC get$G %RDCC%n No file ($0) offered in SEND mode by $1$G %RDCC%n No file offered in SEND mode by $0$G %RDCC%n A previous DCC get:$0 to $0 existsUnknown$G %RDCC%n Unable to open $0: $1--e$G %RDCC%n No file ($0) offered in RESEND mode by $1$G %RDCC%n No file offered in RESEND mode by $0$G %RDCC%n A previous DCC reget:$0 to $0 existsACCEPT$G %RDCC%n Unknown DCC $0 ($1) recieved from $2$G %RDCC%n $0 collision for $1:$2DCC %s collision occured while connecting to %s (%s)$G %RDCC%n Recieved DCC $0 request from $1 while previous session active$G %RDCC%n $0 ($1) request from $2 rejectedIncoming handshake has an address [%s] that could not be figured out!Please use caution in deciding whether to accept it or notWARNING: Fake dcc handshake detected! [%lx]Unless you know where this dcc request is coming fromIt is recommended you ignore it!DCC handshake from %s ignored becuase it had an null port or address$G %RDCC%n Warning: File $0 exists: use /DCC rename if you dont want to overwrite$G %RDCC%n Warning: File $0 renamed: $1already requested connecting%s CHAT %salready requested connecting... %2.4gEbTbGbMbKbbytes%s %s %s %s %s %s %d %s %s%s %s %s %s %s %s %d*Type /chat to answer or /nochat to close$G %RDCC Caution Filesize is 0!! No Autogettregetregettgetget%s %s %s %s$3- Auto-$0ting file %C$1%n from %K[%C$2%K]CpBA0A@$G %RDCC error: accept() failed. punt!!%s CHAT %s %dRemote End Closed ConnectionUnknown command Unknown@CTCP_MESSAGE CTCP_REPLY %d%s %s N %d$G %RDCC raw buffer overrun. Data lost%s %s C%s RAW %s%s %s D %sRaw data on %s from %s: %s$G %RDCC%n reget packet is invalid!!$G %RDCC%n reget starting at $0%s %s %s %s %s %d %d%s %s %s %d %s %d%s SEND %s CONNECTION LOST$G %RDCC get to $0 lost: Remote peer closed connectionwrite to local file failed$G %RDCC%n Warning: incoming file is larger than the handshake said$G %RDCC%n Warning: GET: closing connection$G %RDCC%n No host specified for DCC RAW(null)$G %RDCC No active $0:$1 connection for $2PRIVMSG .chat%c %s %s$G %RDCC%n No active DCC $0:$1 connection for $2$G %RDCC%n No name specified for DCC rawDecNovOctSepAugJulJunMayAprMarFebJan%-2.2d:%-2.2d:%-2.2d %s %-2.2d %d%-5.5s%-3.3s %-9.9s %-8.8s %-20.20s %-8.8s %-8.8s %s%ld%%%ld%ldKArgumentsCompleteSizeStart timeStatusNickTypeOfferedWaitingActiveClosed[E]#$[2]0 $[6]1%Y$2%n $[11]3 $[25]4 $[7]5 $6#$[2]0 $[6]1%Y$2%n $[11]3 $4 $[11]5 $[10]6 $[7]7 $8-#$[2]0 $[6]1%Y$2%n $[11]3 $4 $[-4]5 $[-4]6 $[-3]7 $[-3]8 $[7]9 $10EncryptFileK/sDnum%s %s %s %s %s %s %s%G# %W%n %GT%gype %W%n %GN%gick %W%n %GP%gercent %GC%gomplete %W%n %GK%g/s %W%n %GF%gile%K%n%W%n%K%n%W%n%K%n%W%n%K%n%W%n%K%n%W%n%K%n%W%n%KEN/AWaitCloseOffer%d %s %s %s %s %s %s%d %s %s %s %s %s %s %s%K%n%K%n%K۰%n%K%1%K%0%K%n%K%1%K%0%K%n%K%1%K%0%K%n%K%1%K%0%K%n%K%1%K%R%0%K%n%K%1%K%R%0%K%n%K%1%K%R%nccr%4.1f%%%s %s%s %02d:%02d?????%s %ld %ld %d %d%4.1f%% (%ld of %ld bytes)[%*s] ETA %02d:%02dDCCnum$G %RDCC%n Nothing on DCC list.@Y@?REJECT %s %s%RDCC%n CLOSE number $0 does not exist$G %RDCC%n No DCC $0:$1 to $2 found$G %RDCC%n You must specify a type|dcc_num for DCC close-all$G %RDCC%n close invalid number$G %RDCC%n specify a type and a nick for DCC closeall$G %RDCC%n CLOSE invalid description$G %RDCC%n Unknown type [$0]%s %s %s REJECTED$G %RDCC%n You must specify a nick and a new filename$G %RDCC Too late to rename that file$G %RDCC File $0 from $1 rename to $2$G %RDCC No file $0 from $1 found, or it's too late to renameNOCCLOSE CHAT %sCHAT %s=%sError occurred%2.4g%s%%s %s %%s %%s TRANSFER COMPLETEtofrom%s %s %s %s %s %s %s %s %s@CpBA0A%d%%,[%s]Y@No help availble yetDCC %s %s$G Usage: %W/%R$0%n $1 %K-%n $2-$G %RDCC%n help -$G $[13]0 $[13]1 $[13]2 $[13]3 $[13]4[command] to get help on specific commandsdcc help%d %d$G %RDCC%n DCC Active = $0, Limit = $1$G %RDCC%n DCC Quiet = $0$G %RDCC%n DCC paths is now $0$G %RDCC%n DCC auto rename is now $0 DCC overwrite is now $0 DCC autoget is now $0%6.2f%lu %s %s %lu %s %s %lu %u %u %s %s %s %s%3.2f%s %G%K[%Cdcc transfer stats%K]%G͸ %G %G%g%K[%Cx%cferd %Ci%cn%K]%g-%K[%Cx%cferd %Co%cut%K]%gķ%K[%Ct%cotal %Cf%ciles%K]%g%K[%Ca%cctive%K]%gķ[%Cl%cimit%K]%gķ%G%s %s %d %d %d %G%g %W$[-10]0 %g %W$[-10]1 %g %W$[-10]2 %g %W$[-8]3 %g %W$[-7]4 %g%G %G%gĽĽĽ%G %g%K[%Ci%cn %Cs%ctats%K]%g%K[%Co%cut %Cs%ctats%K]%gķ%K[%Ct%coggles%K]%gķ %g %Cm%nax: %W$[-6]0%n%Rkb/s %g %Cm%nax: %W$[-6]1%n%Rkb/s %g %Ca%nutoget: %W$[-3]2%n %Cp%naths: %W$[-3]3 %g %g %Cm%nin: %W$[-6]0%n%Rkb/s %g %Cm%nin: %W$[-6]1%n%Rkb/s %g %Co%nverwrite: %W$[-3]2%n %Cq%nuiet: %W$[-3]3 %g %gĽĽv@CCpBA0AYou must supply a nickname for DCC RESUMENo file (%s) offered in SEND mode by %sNo file offered in SEND mode by %sDCC RESUME: Cannot use DCC RESUME if the file doesnt exist. [%s|%s]A previous DCC GET:%s to %s exists%hdRESUME %s %d %dACCEPT %s %s %s$G %RDCC%n Auto-closing idle dcc $0 to $1NOTICE %s :Dcc %s Auto Closed$G %RDCC%n Auto-closing Slow dcc $0 to $1 require $2KB/s got $3KB/sNOTICE %s :CDCC Slow dcc %s Auto Closed. Require %sKB/s got %sKB/sdcxdcsdcgdca$G %gFTP%n already transfering a file.PORT %d,%d,%d,%d,%d,%d stor %s BINARY mode data connectionftpsend$G %gFTP%n $0-retr %s ftpgetFTP Attempting to get$G %gFTP%n Attempting to get $0ftpopenlsdir.stat %s morecwdpwdcd%s%s%s put-FTP transfering a file$G %gFTP%n transfering a file.FTP is not connected$G %gFTP%n is not connected.anonymous- bxuser@$G %RDCC%n%s /dcc ftp hostname user passwd [-p port]$G %GFTP%n A previous DCC FTP to $0 exists$G %gFTP%n command failed connectYou must supply a nickname and a filename for DCC XMITclear %lu %d %s$G %gFTP%n command failed write$G %RDCC%n autoget list/no flood list+nick to add, nick to remove/dcc exempt$G: %RDCC%n No such nick on the exempt list %K[%W$0%K]# Dcc Exempt from autoget OFF list DCC EXEMPT +%s DCCexempt %dSaved %d DccExempt entriesALLNOTIFYCRASHSERVER_CONNECTMEMORYWAITSDCC_XMITINBOUNDOUTBOUNDDCC_SEARCHCTCPSLOCAL_VARS[-][+][option(s)] , XDEBUGUnrecognized XDEBUG option '%s'Attempt to use EXEC from within an ON function!Command "%s" not executed!Please read /HELP SET EXEC_PROTECTIONfor important details about this!No processes are runningProcess List: %d (%s) (pid %d): %s %d (pid %d): %sOUTNOTICEPRIVMSGNo current channel in this window for -OUTNAMEYou must specify a logical nameWINDOWMSGNo nicknames specifiedCLOSEINDIRECT%s is not a valid processSignal number can be from 1 to %dNo such signal: %sOutput from process %d (%s) now going to this windowOutput from process %d (%s) not going to any windowexec.cOutput from process %d (%s) now going to %sOutput from process %d (%s) now going to youProcess %d (%s) is now called %sThe name %s is not unique!Unable to start new process: %sCouldn't start new process!*** Error starting shell "%s": %s %s %s%d %s%sClosing all left over exec's%s%s %s %d %d%d %d %dProcess %d (%s) terminated with signal %s (%d)Process %d (%s) disownedProcess %d (%s) terminated with return code %dThere is no such process %dSending signal %s (%d) to process %d: %s--- exec'd process is in my job control session! Something is hosed ---No such process number %dJOINKICKDEOPNICKACTIONCDCCINVITECTCPWALLOPWALLNOTICEPUBLICMSGflood.c%s %s %s %sunknown%s %s %s %s %s%sKICK %s %s :%s flooder*!*%s%d ^IGNORE *!*%s NONETIMERAuto-ignoring %s for %d minutes [%s flood]files.c.awb%s FORMAT_WINDOW_SETFORMAT_WIDELISTFORMAT_WHOWAS_NICKFORMAT_WHOWAS_HEADERFORMAT_WHOLEFT_USERFORMAT_WHOLEFT_HEADERFORMAT_WHOLEFT_FOOTERFORMAT_WHOIS_SIGNONFORMAT_WHOIS_SHITFORMAT_WHOIS_SERVICEFORMAT_WHOIS_SERVERFORMAT_WHOIS_REGISTERFORMAT_WHOIS_OPERFORMAT_WHOIS_NICKFORMAT_WHOIS_NAMEFORMAT_WHOIS_IDLEFORMAT_WHOIS_HELPFORMAT_WHOIS_HEADERFORMAT_WHOIS_FRIENDFORMAT_WHOIS_FOOTERFORMAT_WHOIS_CHANNELSFORMAT_WHOIS_BOTFORMAT_WHOIS_AWAYFORMAT_WHOIS_ADMINFORMAT_WHOFORMAT_WALL_ARFORMAT_WALLOPFORMAT_WALLFORMAT_VERSIONFORMAT_USERS_USERFORMAT_USERS_SHITFORMAT_USERS_HEADERFORMAT_USERS_BOTFORMAT_USERSFORMAT_USERMODEFORMAT_USERLIST_HEADERFORMAT_USERLIST_FOOTERFORMAT_USERLISTFORMAT_USAGEFORMAT_TRACE_USERFORMAT_TRACE_SERVERFORMAT_TRACE_OPERFORMAT_TOPIC_UNSETFORMAT_TOPIC_SETBYFORMAT_TOPIC_CHANGE_HEADERFORMAT_TOPIC_CHANGEFORMAT_TOPICFORMAT_TIMERFORMAT_STATUS3FORMAT_STATUS2FORMAT_STATUS1FORMAT_STATUSFORMAT_SMODEFORMAT_SILENCEFORMAT_SIGNOFFFORMAT_SHITLIST_HEADERFORMAT_SHITLIST_FOOTERFORMAT_SHITLISTFORMAT_SET_NOVALUEFORMAT_SETFORMAT_SERVER_NOTICE_UNAUTHFORMAT_SERVER_NOTICE_TRAFFIC_NORMFORMAT_SERVER_NOTICE_TRAFFIC_HIGHFORMAT_SERVER_NOTICE_STATSFORMAT_SERVER_NOTICE_REHASHFORMAT_SERVER_NOTICE_OPERFORMAT_SERVER_NOTICE_NICKCFORMAT_SERVER_NOTICE_KLINEFORMAT_SERVER_NOTICE_KILL_LOCALFORMAT_SERVER_NOTICE_KILLFORMAT_SERVER_NOTICE_GLINEFORMAT_SERVER_NOTICE_FAKEFORMAT_SERVER_NOTICE_CLIENT_TERMFORMAT_SERVER_NOTICE_CLIENT_INVALIDFORMAT_SERVER_NOTICE_CLIENT_EXITFORMAT_SERVER_NOTICE_CLIENT_CONNECTFORMAT_SERVER_NOTICE_BOT_ALARMFORMAT_SERVER_NOTICE_BOT1FORMAT_SERVER_NOTICE_BOTFORMAT_SERVER_NOTICEFORMAT_SERVER_MSG2_FROMFORMAT_SERVER_MSG2FORMAT_SERVER_MSG1_FROMFORMAT_SERVER_MSG1FORMAT_SERVERFORMAT_SEND_PUBLIC_OTHERFORMAT_SEND_PUBLICFORMAT_SEND_NOTICEFORMAT_SEND_MSGFORMAT_SEND_DCC_CHATFORMAT_SEND_CTCPFORMAT_SEND_AWAYFORMAT_SEND_ACTION_OTHERFORMAT_SEND_ACTIONFORMAT_RELSNFORMAT_RELSMFORMAT_RELSFORMAT_RELNFORMAT_RELMFORMAT_RELFORMAT_PUBLIC_OTHER_ARFORMAT_PUBLIC_OTHERFORMAT_PUBLIC_NOTICE_ARFORMAT_PUBLIC_NOTICEFORMAT_PUBLIC_MSG_ARFORMAT_PUBLIC_MSGFORMAT_PUBLIC_ARFORMAT_PUBLICFORMAT_OVFORMAT_OPERFORMAT_NOTIFY_SIGNON_UHFORMAT_NOTIFY_SIGNONFORMAT_NOTIFY_SIGNOFF_UHFORMAT_NOTIFY_SIGNOFFFORMAT_NOTIFY_ONFORMAT_NOTIFY_OFFFORMAT_NOTICEFORMAT_NOTEFORMAT_NONICKFORMAT_NICK_MSGFORMAT_NICK_COMPFORMAT_NICK_AUTOFORMAT_NICKNAME_USERFORMAT_NICKNAME_OTHERFORMAT_NICKNAMEFORMAT_NETSPLIT_HEADERFORMAT_NETSPLITFORMAT_NETJOINFORMAT_NETADDFORMAT_NAMES_VOICECOLORFORMAT_NAMES_VOICEFORMAT_NAMES_SHITCOLORFORMAT_NAMES_SHITFORMAT_NAMES_OPCOLORFORMAT_NAMES_OPFORMAT_NAMES_NONOPFORMAT_NAMES_NICKCOLORFORMAT_NAMES_IRCOPFORMAT_NAMES_FRIENDCOLORFORMAT_NAMES_FRIENDFORMAT_NAMES_FOOTERFORMAT_NAMES_BOTCOLORFORMAT_NAMES_BOTFORMAT_NAMES_BANNERFORMAT_NAMESFORMAT_MSG_GROUPFORMAT_MSGLOGFORMAT_MSGCOUNTFORMAT_MSGFORMAT_MODE_CHANNELFORMAT_MODEFORMAT_MAILFORMAT_LISTFORMAT_LINKSFORMAT_LEAVEFORMAT_KILLFORMAT_KICK_USERFORMAT_KICKFORMAT_JOINFORMAT_INVITE_USERFORMAT_INVITEFORMAT_IGNORE_WALLFORMAT_IGNORE_NOTICEFORMAT_IGNORE_MSG_AWAYFORMAT_IGNORE_MSGFORMAT_IGNORE_INVITEFORMAT_HOOKFORMAT_HELPFORMAT_FRIEND_JOINFORMAT_FLOODFORMAT_ENCRYPTED_PRIVMSGFORMAT_ENCRYPTED_NOTICEFORMAT_DISCONNECTFORMAT_DESYNCFORMAT_DCC_REQUESTFORMAT_DCC_LOSTFORMAT_DCC_ERRORFORMAT_DCC_CONNECTFORMAT_DCC_CHATFORMAT_DCCFORMAT_CTCP_USERFORMAT_CTCP_UNKNOWN_USERFORMAT_CTCP_UNKNOWNFORMAT_CTCP_REPLYFORMAT_CTCP_FUNC_USERFORMAT_CTCP_FUNCFORMAT_CTCP_CLOAK_USERFORMAT_CTCP_CLOAK_UNKNOWN_USERFORMAT_CTCP_CLOAK_UNKNOWNFORMAT_CTCP_CLOAK_FUNC_USERFORMAT_CTCP_CLOAK_FUNCFORMAT_CTCP_CLOAKFORMAT_CTCPFORMAT_CSETFORMAT_CONNECTFORMAT_CHANNEL_SIGNOFFFORMAT_BWALLFORMAT_BOT_HEADERFORMAT_BOT_FOOTERFORMAT_BOTFORMAT_BITCHFORMAT_BANS_HEADERFORMAT_BANSFORMAT_BACKFORMAT_AWAYFORMAT_ASSIGNFORMAT_ALIASFORMAT_ACTION_USER_ARFORMAT_ACTION_USERFORMAT_ACTION_OTHER_ARFORMAT_ACTION_OTHERFORMAT_ACTION_ARFORMAT_ACTIONFORMAT_476FORMAT_475FORMAT_474FORMAT_473FORMAT_471FORMAT_443FORMAT_391FORMAT_381fset.c%s %s%sValue of %s set to %sFSET_type not supportedNo such variable "%s"%s is ambiguous%K>%n>%W> You are now a %GIRC%n whore$G [$1] Channel is full$G [$1] Invite only channel$G [$1] Banned from channel$G [$1] Bad channel key$G [$1] You are not opped%K %W$1 %n$4-%K %Y$1 %n$4-%K* %n>%c$1 %n$3-%K* %y>%c$1 %n$3-Alias $[20.]0 $1-Assign $[20.]0 $1- is away: ($3-) $1 $2is back from the dead. Gone $1 hrs $2 min $3 secs# Channel SetBy Sec Ban$[2]0 $[10]1 $[10]3 $[-5]numdiff($time() $4) $2%RBitch Mode Activated%n $1 $4 $5 on $3Aop Prot Bot Channel HostnameThere are $1 on the BotList$[2]0 $[2]1 $[11]2 $[10]3 $4[%GBX-Wall%n/%W$1:$2%n] $4-$G %nSignOff %W$1%n: $3 %K(%n$4-%K)$G Connecting to server $1/%c$2%n%K>%n>%W> %G$1 %K[%g$2%K]%g requested $4- from $3%K>%n>%W> %C$1 %K[%c$2%K]%c requested $4- from $3%K>%n>%W> %C$1 %K[%c$2%K]%c requested $4- from you%K>%n>%W> %C$1 %K[%c$2%K]%c requested unknown ctcp $4- from $3%K>%n>%W> %G$1 %K[%g$2%K]%g requested $4- from you%K>%n>%W> %G$1 %K[%g$2%K]%g requested unknown ctcp $4- from $3%K>%n>%W> %G$1 %K[%g$2%K]%g requested unknown ctcp $4- from %g$3$G %nCTCP %W$3 %nreply from %n$1: $4-%K[%G$1%K(%gdcc%K)] %n$3-$G %RDCC%n $1 %nconnection with %W$2%K[%c$4, port $5%K]%n established$G %RDCC%n lost %w$1%w %rto $2 %K[%w$3-%K]$G %RDCC%n %W$1%n:%g$2%n %K[%C$3%K]%n $4 $5 completed in $6 secs %K(%W$7 $8/sec%K)$G %RDCC%n $1 %K(%n$2%K)%n request from %W$3%K[%c$4 [$5:$6]%K]%n $8 $7$G $1 is desynced from $2 at $0$G Use %G/Server%n to connect to a server%K-%Y$1%K(%p$2%K)-%n $3-%K[%Y$1%K(%p$2%K)]%n $3-%Y$1%n flood detected from %G$2%K(%g$3%K)%n on %K[%G$4%K]$G %R$1 %K[%c$2%K]%n has joined $3$0-%K>%n>%W> $1 Invites You to $2-%K>%n>%W> Inviting $1 to $2-$G %C$1 %K[%c$2%K]%n has joined $3$G %n$3 was kicked off $2 by %c$1 %K(%n$4-%K)%K>%n>%W> %WYou%n have been kicked off %c$2%n by %c$1 %K(%n$4-%K)%K>%n>%W> %RYou have been killed by $1 for $2-$G $1 %K[%w$2%K]%n has left $3 %K[%W$4%K]%K%n$[24]0%K %n$[24]1%K %n$[3]2%K %n$[13]3%K$[12]1 $[-5]2 $[40]3-%K>%n>%W> You have new Mail[$0-][$[8]0] [$1] - $2-$G %nmode%K/%c$3 %K[%W$4-%K]%n by %W$1$G %RServerMode%K/%c$3 %K[%W$4-%K]%n by %W$1%K[%P$1%K(%p$2%K)]%n $3-%C$1 %K[%c$2%K]%n is now %Wan%w %GIRC%n whore%K>%n>%W> You have been invited to $1-%K[%P$1%P$2%K(%p$3%K)]%n $4-%K-%P$2%K(%p$3%K)-%n $4-%K%P$1%n $2-%K-%P$1%K:%p$2%K-%n $3-$G %K[%GUsers%K(%g$1%K:%g$2%K)]%c $3$G %K[%GBots%K(%g$1%K:%g$2%K)]%c $3$G %K[%GFriends%K(%g$1%K:%g$2%K)]%c $3%K[%C$0%G$[10]1%K]%K[%C$0%Y$[10]1%K]%K[%B $[10]1%K]$G %K[%GNonChanOps%K(%g$1%K:%g$2%K)]%c $3%K[%Mv%B$[10]1%K]$G %K[%GChanOps%K(%g$1%K:%g$2%K)]%c $3$G %K[%GIrcOps%K(%g$1%K:%g$2%K)]%c $3$G %K[%MShitUsers%K(%m$1%K:%m$2%K)]%c $3%K[%C$0%n%R$[10]1%K]$G %K[%MVoiceUsers%K(%m$1%K:%m$2%K)]%c $3%K[%C$0%n%B$[10]1%K]$G %nAdded: %W$1 $2$G %nNetjoined: %W$1 $2$G %nNetSplit detected: %W$1%n split from %W$2 %K[%c$0%K]$G %W$1 %nis now known as %c$3$G %W$1 %nis now known as %c$4%K>%n>%W> %WYou%K(%n$1%K)%n are now known as %c$3%W$1%K:%n $3-($0) ($1) ($2) ($3) ($4) ($5-)%K-%P$1%K(%p$2%K)-%n $3-%K[%rmsg->$1%K]%n $4-%K-%P$1%K(%p$2%K)-%n $4-%K[%P%P$1%K(%p$2%K)]%n $4-%K[%rnotice%K(%R$1%K)] %n$2-$1-%K[%rmsg%K(%R$1%K)] %n$2-$G %GSignoff%n by %r$[10]1%n at $0$G %GSignoff%n by %r$1%K!%r$2%n at $0$G %GSignon%n by %R$1%K!%R$2%n at $0$G %GSignon%n by %r$[-10]1%n at $0%b<%n$1%b>%n $3-%b<%Y$1%b>%n $3-%b(%n$1%K/%n$3%b)%n $4-%b(%Y$1%K/%Y$3%b)%n $4-%K-%P$1%K:%p$3%K-%n $4-%K-%G$1%K:%g$3%K-%n $4-%b<%n$1%K:%n$2%b>%n $3-%b<%Y$1%K:%n$2%b>%n $3-%K %W$1 %n$3-%K %n-> %W$1%n/%c$2 %n$3-[Away ($strftime($1 %a %b %d %I:%M%p))] [Current ($strftime($0 %a %b %d %I:%M%p))] [BX-MsgLog $2]%K[%rctcp%K(%R$1%K)] %n$2%K[%rdcc%K(%R$1%K)] %n$2-%K[%rmsg%K(%R$1%K)] %n$3-%K[%rnotice%K(%R$1%K)] %n$3-%p<%n$2%p>%n $3-%p<%n$2%K:%n$1%p>%n $3-$G%n $1: $2-$G%n $1-%G!%g$1%G%n $2-Possible bot: %C$1 %K[%c$2-%K]%nPossible $1 bot: %C$2 %K[%c$3-%K]%n$1 alarm activated: %C$2 %K[%c$3-%K]%nClient Connecting: %C$1 %K[%c$2-%K]%nClient Exiting: %C$1 %K[%c$2-%K]%nInvalid username: %C$1 %K[%c$2-%K]%nTerminating client for excess flood %C$1%K [%c$2-%K]%nFake Mode detected on $1 -> $2-Foreign OperKill: %W$1%n killed %c$2%n %K(%n$3-%K)%nLocal OperKill: %W$1%n killed %c$2%n %K(%n$3-%K)%n%W$1%n added a new K-Line %K[%c$2%K]%n for $3-%W$1%n added a new K-Line %K[%c$2%K]%n from $3 for $4-Nick collision: %W$1%n killed %c$2%n %K(%n$3-%K)%n%C$1 %K[%c$2%K]%n is now %Wa%w %GIRC%n whore%W$1%n is rehashing the Server config fileStats $1: %C$2 %K[%c$3-%K]%nEntering high-traffic mode %K(%n$1 > $2-%K)%nResuming standard operation %K(%n$1 $2 $3-%K)%nUnauthorized Connection from $1-%g$[-30.]0 %w$1-%r$[-14]1 %R$[-20.]0 %w$[-5]2-%g$[-30.]0 has no value $[3]0 $[34]1 $[10]2 $3-There are $1 users on the shitlist lvl nick!user@host channels reason$G %nSignOff: %W$1 %K(%n$3-%K)$G %RWe are $1 silencing $2 at $0%R$1%n %K[%n$3%K]%R$1%n $2 $3 $4 %K[%n$5%K]%n $6-$G $[-5]0 $[-10]1 $[-6]2 $3-$G Topic for %c$1%K:%n $2-$G %W$1 %nhas changed the topic on channel $2 to%K:%n $3-$G %ntopic set by %c$2%K [%c$stime($3)%K]$G %ntopic unset by $1 on $2$G Usage: /$0 $1-$G %nMode change %K[%W$4-%K]%n for user %c$3$[16]0 $[10]1 $[-10]2 $[-25]3 $[10]4There are $1 users on the userlistlevel nick password host channels%K[%n$[10]1%K]%K[%n%C$4%B$[9]2%K]%K[%n$[33]3%K] %K[%n$0%K]%K[%n$[10]1%K]%K[%n%C$4%B$[9]2%K]%K[%n%B$[33]3%K]%K[%n$0%K]%K[%n$[10]1%K]%K[%n%C$4%B$[9]2%K]%K[%n%r$[33]3%K]%K[%n$[-16]0%K]%K[ %WC%nhannel %K][ %WN%wickname %K][%n %Wu%wser@host %K][%n %Wl%wevel %K]$0+$4$5 by panasync - $2 $3%G!%g$1:$2%G!%n $3-%G!%g$1$2%G!%n $3-%Y$[10]0 %W$[10]1%w %c$[3]2 %w$3%R@%w$4 ($6-)%K| %Wa%nway : $0 - $1-%g| %Wb%not : A:$0 P:$1 [$2] $3-%g| %Wc%nhannels : $0-%g| %Wf%nriend : F:$0 $1-%G---%g%G--%g%G-%g---%K%g--%K%g-%K--- -- -%K: %Wi%ndle : $0 hours $1 mins $2 secs (signon: $stime($3))%g| %Ws%nhit : L:$0 [$1] $2 $3-%K %Ws%nignon : $0-%G %Wi%nrcname : $0-%G| %W$0 %K(%n$1@$2%K) %K(%W$3-%K)%K| %Wo%nperator : $0 $1-%K %Ws%nerver : $0 ($1-)%G %WWho %G%g---%G%g--%G%g-%G %WChannel%g %wServer %G-%g--%G%g--%G%g %wSeconds%G|%n $[-10]0!$[20]1 $[10]2 $[20]4 $3%G| %W$0%n was %K(%n$1@$2%K)%K| %Wa%ndmin : $0 - $1-%K| %Ws%nervice : $0 - $1-%K| %Wh%nelp : $0 - $1-%K| %Wr%negister : $0 - $1-$0 $1 $2-$0:$1-%4%W$0-$[10]0 $[35]1 $[-6]2 $[-10]3 $4 $5$[10]0 $[35]1 $[-6]2 $[-10]3 $4-%S %>[OperView] %s/%s.formatswCannot open file %s for saving!SET %s %s SET -%s Saved %d formats to %sWRITESOCKETWRITEBWRITEWORDWINVISIBLEWINSIZEWINSERVWINREFSWINNUMWINNICKLISTWINNAMWINLENWINCHANWINBOUNDWHICHVERSIONUTIMEUSERMODEUSERHOSTUPTIMEUNSHIFTUNLINKUNIQUNAMEUMASKUHOSTTWIDDLETRUNCTRTOWTOUPPERTOLOWERTIMETDIFF2TDIFFSTRSTRSTRLENSTRIPMIRCSTRIPANSICODESSTRIPANSISTRIPSTRFTIMESTIMESTATUSSTATSPARSESRANDSPLITSPLICESORTSHIFTSETITEMSETINFOSERVERNICKSERVERNAMESENDCDCCSARRWORDRSTRSTRRPATTERNROT13RMDIRRMATCHITEMRMATCHRINDEXRIGHTWRIGHTRFILTERREVWREVERSERESTWREPEATRENAMEREMWREADSOCKETREGFREEREGEXECREGERRORREGCOMPREADRANDOMNICKRANDQUERYWINPUSHPPIDPOPPIDPATTERNPASSPADOPENSOCKETOPENONCHANNELNUMWORDSNUMSORTNUMONCHANNELNUMITEMSNUMDIFFNUMARRAYSNOTWNOTIFYNOCHOPSNAMETOIPMYSERVERSMYCHANNELSMSARMKDIRMIRCANSIMIDWMIDMATCHITEMMATCHMASKLONGIPLISTENLEFTWLEFTPCLEFTLASTSERVERLASTNOTICELASTMESSAGEKEYJOTITEMTOINDEXISVOICEISUSERISOPISNUMISIGNOREDISDIGITISCONNECTEDISCHANOPISCHANNELISBANISALPHAIRCLIBIPTONAMEINSERTWINFOINDEXTOITEMINDEXIGETITEMIFINDITEMIFINDFIRSTIDLEHELPGLOBGETVARGETTABKEYGETRMATCHESGETREASONGETMATCHESGETKEYGETITEMGETINFOGETHOSTGETENVGETCDCCGETARRAYSGEOMFTIMEFSIZEFROMWFPARSEFNEXISTFLASHFINDWFINDITEMFILTERFEXISTEPICEOFENCODEELEETDIFFDELITEMDELARRAYDECODECURRCHANSCURPOSCRYPTCPARSECOUNTRYCOUNTANSICOUNTCOPATTERNCOOL2COOLCONVERTCONNECTCOMMONCLUSTERCLOSESOCKETCLOSECHRCHOPSCHNGWCHMODCHECKUSERCHECKSHITCHANWINCHANUSERSCHANNICKSCHANNELCHANMODECEXISTCENTERBMATCHBITCHXBEFOREWBEFOREBCOPYBANONCHANNELASCIIANNOYALIASCTLAFTERWAFTERADDTABKEYABSSTRLEN_%sfunctions.cDEBUG_FUNC[%d]: %s %d links %d hitsFunction %s(%s) returned %sBitchX$%ld%s@%s%03d%s1{}()"%d/@%ld day%s %ld hour%s %ld minute%s %ld second%s,*unknown2.8u2.8u2.9u2.102.9u3.0Unknown%%.%de%f%%10.%dlf%ldd %ldh %ldm %lds%ld %ld%s+%s%d %d%ldd %ldh %ldm %lds%d %s %s %s**B00**EMSI_IRQ8E08[[#8[?3;5h(0#8[?3;5h(0]%s %s %s %s %sAUTOREPLYonoffserv.USER %d %s %sSHIT %s %d %s%*s%d %s %luA+"no regex support%s %r%*!%s@%s.%s*!*%s@%s.%s*!*@%s.%s*!*%s@*.%s*!*@*.%s%s!%s@%s.%s%s!*%s@%s.%s%s!*@%s.%s%s!*%s@*.%s%s!*@*.%sfunny.c%s(%d) %s%s %s%%s %%-%u.%us %%-5s %%s%%s %%s %%-5s %%sPrv%s %s %s %s%s %s %s%c %s$ %s %s %s %d%%s: %%-%u.%us %%s%s: %s %sPubSec%s %s %s %s %sMODE %s +%sHOME.hash.cHASH_ERROR: next_nicklistHASH_ERROR: next_namelistHASH DEBUG: %d links %d hits %dHASH_DEBUG: %d:%d %s!%sHASH_DEBUG: %d:%d %10s %s!%sWHOWAS_HASH_ERROR: next_userhostWhoWas %s Cache Stats: %lu hits %lu links %lu unlinks%d %s %s %s%K[%W$[3]0%K] %Y$[10]1 %W$2%G!%c$3%sServerTimeChannelHostNick%s %s %s %s %s %sUnknown%s %s %s %ld %s %s%s %s %s %l %shistory.c* Command History:%d: %s%s %sNo MatchNo such history entry: %dNOISYNORMALQUIETSILENTYELLWINDOW_SWAPWINDOW_KILLWINDOW_CREATEWINDOWWIDELISTWHOLEFT_HEADERWHOLEFTWHOWALLOPWALLUSERS_SERVER_HEADERUSERS_SERVERUSERS_HEADERUSERSUSERLIST_HEADERUSERLISTUSAGETOPICTIMER_HOURTIMERSTATUS_UPDATESTAT_HEADERSTATSILENCESIGNOFFSHOWIDLESHOWIDLE_HEADERSHITLIST_HEADERSHITLISTSETSERVER_NOTICE_SERVER_KILLSERVER_NOTICE_LOCAL_KILLSERVER_NOTICESERVER_NOTICE_KILLSERVER_NOTICE_FOREIGN_KILLSERVER_NOTICE_FAKES_MYCHANNELSERVER_NOTICE_FAKESSEND_TO_SERVERSEND_PUBLICSEND_NOTICESEND_MSGSEND_DCC_CHATSEND_ACTIONSAVEFILEPRESAVEFILEPOSTSAVEFILEREDIRECTRAW_IRCPUBLIC_OTHERPUBLIC_NOTICEPUBLIC_MSGPUBLICODD_SERVER_STUFFNSLOOKUPNOTIFY_SIGNON_UHNOTIFY_SIGNONNOTIFY_SIGNOFF_UHNOTIFY_SIGNOFFNOTIFY_HEADERNOTICENOTENICKNAMENAMESMSGLOGMSG_GROUPMSGMODE_STRIPPEDMODEMAILLLOOK_SPLITLLOOK_JOINLLOOK_ADDEDLISTLEAVEKICKJOIN_MEJOININVITEINPUTIDLEHOOKHELPTOPICHELPSUBJECTHELPFTPFLOODEXITEXEC_PROMPTEXEC_EXITEXEC_ERRORSEXECENCRYPTED_PRIVMSGENCRYPTED_NOTICEDISCONNECTDESYNC_MESSAGEDCC_TRANSFER_STATDCC_STATF1DCC_STATFDCC_STATDCC_REQUESTDCC_RAWDCC_POSTDCC_LOSTDCC_HEADERDCC_ERRORDCC_CONNECTDCC_CHATCTCP_REPLYCTCPCONNECTCLONE_READCHANNEL_SYNCHCHANNEL_SWITCHCHANNEL_STATSCHANNEL_SIGNOFFCHANNEL_NICKCDCC_SEND_NICKCDCC_QUEUEHCDCC_QUEUECDCC_PREPACKCDCC_POSTPACKCDCC_PACKCDCC_NOTEBOTLIST_HEADERBOTLISTBANS_HEADERBANSAR_REPLYAR_PUBLIC_OTHERAR_PUBLICACTIONhook.cDEBUG_HOOK: %s[%d][cnt %d] [links %d hits %d] % *%3.3u Exclusivenothing%s %c %s %c %s %s %d Server %d %s%sOn %s from %c%s%c do %s [%s] <%d> (Server %d)%s%s %c %s %c %s %s %dOn %s from %c%s%c do %s [%s] <%d>%s activated by %c%s%c%c%s%c removed from %s listThe %s list is empty"%s" is not on the %s listThe %s <%d> list is empty^-+ON #%s%s %dON %s%s %c%s%c %s You must specify an event type!Numerics must be between 001 and 999No such ON function: %sAmbiguous ON function: %sNo serial number specifiedYou cannot use /ON INPUT with INPUT_PROTECTION setPlease read /HELP ON INPUT, and /HELP SET INPUT_PROTECTIONNo expression specifiedUnmatched brace in ONOn %3.3u from %c%s%c do %s [%s] <%d>The %3.3u list is empty.The %s list is empty.ON listings:All ON lists are empty.Expression syntaxUnmatched '%c'(expr) {true} [ELSIF (expr) {true}] [ELSE] {false}IF: Missing expression%s expression expands to: (%s)if.celsif else DO: unbalanced {whileDO: unbalanced (WHILEWHILE: missing boolean expressionFOREACH: missing structure expressionFOREACH: missing variableFOREACH: missing statementFE%s: Missing List for /%s%s: Missing commands%s: You did not specify any variables%s: Too many variables%s: Missing }FOR: missing closing parenthesisFOR: no components!FOR: Only two components!FOR: badly formed commandsSWITCH: String to be matched not found where expectedSWITCH: Execution body not found where expectedSWITCH: Case label not found where expectedSWITCH: case body not found where expectedignore.c%s is not on the ignorance listNot ignoringNever ignoringHighlightingChannel GrepIgnoringHighlighting ALL messages from %sGrepping ALL messages from %sNever ignoring messages from %sIgnoring ALL messages from %s MSGS PUBLIC WALLS WALLOPS INVITES NOTICES NOTES CTCPS CRAP CDCC KICKS MODES SMODES JOINS TOPICS QUITS PARTS NICKS PONGS SPLITS%s from %s%s removed from ignorance list%s is not in the ignorance list!Ignorance List: ALLALL DONT-ALLPUBLIC DONT-PUBLICMSG DONT-MSGSWALL DONT-WALLSWALLOPS DONT-WALLOPSINVITES DONT-INVITESNOTICES DONT-NOTICESNOTES DONT-NOTESCTCPS DONT-CTCPSCDCC DONT-CDCCKICKS DONT-KICKSMODES DONT-MODESSMODES DONT-SMODESJOINS DONT-JOINSTOPICS DONT-TOPICSQUITS DONT-QUITSPARTS DONT-PARTSNICKS DONT-NICKSPONGS DONT-PONGSSPLITS DONT-SPLITSCRAP DONT-CRAP EXCEPT CGREP ] [%d %s %s %K[%G$[-2]0%K] %C$[-25]1%W:%n $2-%sThere are no nicknames or channels being ignoredMSGSWALLSNONE EXCEPT %sYou must specify one of the following: ALL MSGS PUBLIC WALLS WALLOPS INVITES NOTICES NOTES CTCPS CDCC KICKS MODES SMODES JOINS TOPICS QUITS PARTS NICKS PONGS SQUITS CRAP NONEEXCEPTBOLDINVERSEUNDERLINE*%s!%s@.!Removed %d ignores and %d exceptionsNo matching ignoranceWhich ignore to delete (-2, 2-5, ...) ? input.c/msg%s%s %s %s%s%s %s%s: %s%s%c%sINDEXCTCP Cloaking is now [%s]SWAP %d-opschops-nonopsnopsWINDOWJOIN %sAlready joining %sYou haven't been invited to a channel yet%sig %sBitchX-74p2*p19980105@%s -- just do it.%s yesIRC][ %s: Rest in peaceDo you really want to quit? User abort with 5 Ctrl-C'sGot SIGUSR1, closing DCC connections and EXECed processesBitchX version %s (%s)                   ߲      ۲                           ۲ ޲۲  ߲        ۲   ܰ ܰ۲      ۲             ۰ ۲        Pe^     ݰ ݰ          ߰     ܲ            ߲      ޲                                         PhonyEye  ۲     [%15s]  ^  ߰Awe/Cia                          ۲                                  ۲    ۲     ۲      ۲                     by panasync                    *Spark it Up*    [Joker]       ܲ       ߱  ߲߱ ܲ ߱߱ ߱         ܱ           ߱ܲ   ߱         ߱  ߱    ۲ ܱ   ߲ܲ     ߲p޲    X    ߱      %17s irc client  -by Panasync ߱۲۲۲                                ۲۲  ۲۲ nd۲۲ ۲۲       ۲۲  ۲       ݲ          ۲ ߰  ߰          ޲  ޲޲  ޲   ܲ   ޲             ۲          ܲ  bitchx!                         ۲۲   ۲      ۲   ߲       ߲    ۱                      sty (twilght.                             ۲    ܰ       ߰۲                    ۲ ݰ    ۲        ߲    ܱ  ߲   ۲      ܲ ߱    ۲   enx!  ۲      ܲ۲            .the bitch of IrC.                                       fiction                             ܰ                               ߱                                                                  ܲ         [_v9(Vade79)FiRE]        ۲         ߲  ۲   ܰ       ۲ ߲ ۲                         ߲                                ۲  ۲۰         ۲  ۲          ۲  ߲      ޲۰                  ߲   ۰                           ܲ   ۲  ߰    ۰     ۲ ܰ        ܲ      ߰   ۲     ܰ   ܲ                   ..B i t c h X..                                  ۲߲  ߲  ܱ        ޲ ޲߲ ۲   ۲               ۲             ޲ ߲    ܲ                     ܲ  ޲       ܰ۲     ۲     ۲    ۲             ۲߰              ܲ                             ߲    dark horizon(dh!toolshed)                 [%s by panasync]     &@AMissing paramater after -c irc.cMissing paramater after -p Ignoring junk after -f Ignoring junk after -F Ignoring junk after -d Missing argument to -l Missing argument to -L Missing argument to -r Ignoring junk after -a Ignoring junk after -q Ignoring junk after -B Usage of -bl is decprecated: use -b -l instead. Missing argument for -n Ignoring junk after -x You forgot to specify a hostname Unknown flag: %s %s%s%s.ircserversIRCLIB//usr/local/lib/irc/IRCRCIRCNICKIRCUMODE* I'm to lame to read BitchX.doc *IRCNAMENAMEIRCPATH~/.irc:/usr/local/lib/irc/script:~/.BitchX:.HOMEIRCUSERUSER~/%srUnknownIRC_HOSTIRCHOSTYour hostname appears to be [%s] Illegal nickname %s Please restart IRC II with a valid nickname /.ircrc%s/.bitchxrcIRCPORTIRCSERVER[efnet] irc.cs.cmu.edu irc.visi.com irc.videotron.ab.ca irc.total.net:6660 [fefnet] raistlin.toledolink.com [efnet] irc.nwlink.com irc.nol.net irc.undernet.org::::undernet [other] anv2.myweb.net irc.is.a.badhabit.org*** Trying to /parsekey send_line will not workdumb_modeIllegal call to get_line get lineget_line: input == -1 is illegal valueget a charMoving from io level [%d] to level [%d] from [%s]io's nesting level is [%d], [%s]<-[%s]<-[%s]<-[%s]<-[%s]<-[%s]Ahoy there matey! Abandon ship!Select failed with [%s]LINKSProcess [%d] connected to tty [%s] w/dev/nullget_line() returnedMalloc() failed, giving up!*** failed calloc %s (%d)*ircaux.c^ ^ "\ npr0/An unrecoverable logic error has occured.edwac@sk.sympatico.caPlease email %s giving me the following messagePanic: [%s:%s %s]Panic: %d @ %sSome kinda error at %s (%d)BitchX panic... Could it possibly be a bug? Nahhhh...Cannot start decompression: %s -crPATHgunzipuncompress.gz.zCannot open file %s because gunzip was not found.ZCannot open file %s because uncompress was not foundFile not found: %s%s is a directoryCannot open %s -- executable fileCannot open compressed file %s becuase no uncompressor was foundCannot open file %s: %s.AsOnOff.META%d-%s%s is bound to %s %s%s%s is bound to NOTHINGIllegal key sequence: ^%cMETAALTNo such function: %sAmbiguous function name: %s%sNo such function %sAmbigious function %sspaceKey sequences may not contain more than two keysYANK_FROM_CUTBUFFERWINDOW_SWAP_10WINDOW_SWAP_9WINDOW_SWAP_8WINDOW_SWAP_7WINDOW_SWAP_6WINDOW_SWAP_5WINDOW_SWAP_4WINDOW_SWAP_3WINDOW_SWAP_2WINDOW_SWAP_1WINDOW_SHRINK_ONEWINDOW_MOVEWINDOW_LISTWINDOW_KILLWINDOW_HIDEWINDOW_HELPWINDOW_GROW_ONEWINDOW_BALANCEWHOLEFTUNSTOP_ALL_WINDOWSUNDERLINEUNCLEAR_TEXTTYPE_TEXTTRANSPOSE_CHARACTERSTOGGLE_STOP_SCREENTOGGLE_INSERT_MODETOGGLE_CLOAKTAB_MSG_BACKTAB_MSGSWITCH_CHANNELSSWAP_PREVIOUS_WINDOWSWAP_NEXT_WINDOWSWAP_LAST_WINDOWSTOP_IRCSHOVE_TO_HISTORYSEND_LINESELF_INSERTSCROLL_STARTSCROLL_FORWARDSCROLL_ENDSCROLL_BACKWARDREVERSEREFRESH_SCREENREFRESH_INPUTLINEQUOTE_CHARACTERQUIT_IRCPREVIOUS_WINDOWPARSE_COMMANDNOTHINGNICK_COMPLETIONNEXT_WINDOWNEW_SCROLL_FORWARDNEW_SCROLL_ENDNEW_SCROLL_BACKWARDNEW_BEGINNING_OF_LINEMETA9_CHARACTERMETA8_CHARACTERMETA7_CHARACTERMETA6_CHARACTERMETA5_CHARACTERMETA4_CHARACTERMETA3_CHARACTERMETA2_CHARACTERMETA1_CHARACTERJOIN_LAST_INVITEIGNORE_NICKHIGHLIGHT_OFFFORWARD_WORDFORWARD_HISTORYFORWARD_CHARACTERERASE_TO_END_OF_LINEERASE_TO_BEG_OF_LINEERASE_LINEEND_OF_LINEDELETE_TO_PREVIOUS_WORDDELETE_PREVIOUS_WORDDELETE_NEXT_WORDDELETE_CHARACTERDCC_STATSDCC_PLISTCPU_SAVERCOMMAND_COMPLETIONCLEAR_SCREENCHELPCHANGE_TO_SPLITCHANNEL_NONOPSCHANNEL_CHOPSCDCC_PLISTBOLDBLINKBEGINNING_OF_LINEBACKWARD_WORDBACKWARD_HISTORYBACKWARD_CHARACTERBACKSPACEAUTOREPLY_BACKAUTOREPLYkeys.cBIND %s%s %s %s KILLSEND_MSGTCLBEEPUSERLOG5USERLOG4USERLOG3USERLOG2USERLOG1CTCPDCCACTIONSSNOTESOPNOTESNOTESWALLOPSWALLSNOTICESMSGSPUBLICCRAPALLNONE Unknown lastlog level: %slastlog.cMAXLITERALSecond -LITERAL argument ignoredNeed pattern for -LITERAL-BEEP is exclusive; ignoredCLEARCleared lastlogFILEwcannot open file %sFilename needed for saveUnknown flag: %sLastlog:*%s*%s*%s End of LastlogUnknown%s %s %s %s[$[10]0] [$1] - $2-%s/%sOnatwtMsgLog started [%s] Now logging messages to: %sOffMsgLog ended [%s] [TimeStamp %s] Bad Flag passed to logmsg$G Away logging set to: $0-$G Away logging currently: $0-Logging is already onSET LOGFILE: No such userawStarting logfile %sIRC log started %.24s Couldn't open logfile %s: %slog.cIRC log ended %.24s Logfile endedYou must set the LOGFILE variable first!%s MAILmail.c//var/spool/mail\|/-YesMail%s %s%s %s %s%s%crFrom %d %dYou have new email.%dmisc.c%2ldd %2ldh %2ldm %2lds%G[ %WBitchX%g%wClient%g%RStatistics %G]---%g--%K-%g--%G--%K-%g--- %K--%g -%s%s %s%G| %CClient Version: %W$0 $1%G %CClient Running Since %W$0-%G| %CClient Uptime: %W$0-%G %CCurrent UserName: %W$0-%G: %CCurrent RealName: %W$0-None%G. %CLast Recv Message: %W$0-%G: %CLast Recv Notice: %W$0-%G. %CLast Sent Msg: %W$0-%G: %CLast Sent Notice: %W$0-%G %CLast Channel invited to: %R$0-%d%G| %cTotal Users on Userlist: %K[%R$0%K]%G %cTotal Users on Shitlist: %K[%R$0%K]edwac@sasknet.sk.caInternal error: notify %sError in ttyname()Error in stat()Mesg is OnMesg is OffONYESOFFNOMesgSorry, couldnt set your tty's modePING %lu %sMODE %s -b %s%s %s*!*%sMODE %s +b %s*!*%sKICK %s %s :%s: (Idle Channel User)%d %sUNIdle checking turned %s for %sIdle checking turned %s for %s %d mins%s %ld$G %W$a%n: Idle check for %W$0%n Max Idle Time %K[%W$1- %K]%s %s %d %ld$[20]0 Idle%W: %K[%n$1- %K] found idle user %-12s channel %s# %s Idle Channel list ADDIDLE %s %d Idle %dSaved %d Idle channels-ALL, ()%s %s %s %lu %lu %lu %lu %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %s$G %CInformation for channels %K: %W$0%d %d %d %d MEM usage%K:%w Total%K:%w %c$0 bytes %K[%cNicks $1 b Chan $2 b Bans $3 b%K]Ops %K[%W$[-5]0%K]%w De-Ops %K[%W$[-5]1%K]%w Bans %K[%W$[-5]2%K]%w Unbans %K[%W$[-5]3%K]%wTopics %K[%W$[-5]0%K]%w Kicks %K[%W$[-5]1%K]%w Publics %K[%W$[-5]2%K]%w Parts %K[%W$[-5]3%K]%wSignoffs %K[%W$[-5]0%K]%w Joins %K[%W$[-5]1%K]%w TotalBans %K[%W$[-5]2%K]%w MaxBans %K[%W$[-5]3%K]%wServOps %K[%W$[-5]0%K]%w ServDeop %K[%W$[-5]1%K]%w ServBans %K[%W$[-5]2%K]%w ServUB %K[%W$[-5]3%K]%wUsers Here %K[%W$[-5]0%K]%w Users Away %K[%W$[-5]1%K]%w Opped %K[%W$[-5]2%K]%w Unopped %K[%W$[-5]3%K]%w%d %dTotalNicks %K[%W$[-5]0%K]%w MaxNicks %K[%W$[-5]1%K]%wIRCops %K[%W$[3]0%K]%w$1-Try joining a channel first%s %s %s %ld %ld %ld %ld %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %s$G %CInformation for channel %K: %W$0$G %CChannel created %K: %W$0 $1 $2 $3%n in memory %W$4-EnabledDisabledno %CThere is %R$0%C limit and limit checking is %R$1- %CIdle user check is %K[%R$0-%K]MODE %s -o+b %s *!*%sKICK %s %s :Join flood (%d joins in %dsecs of %dsecs)%d %s *!*%sMODE %s -o %sKICK %s %s :De-op flood (%d de-ops in %dsecs of %dsecs)Illegal what %d passed to update_stats%G%WBitchX%G%WUsage%G%WStatistics%G%g---%G%g--%G%g-%G%g---%K%g--%K%g-%K%d %d %d %d %d %d%G| %CCPU %cUsage: Secs %W$[-2]0%n:%W$[-2]1%n %K[%CU%cser %W$[-2]2%n:%W$[-2]3 %CS%cystem %W$[-2]4%n:%W$[-2]5%K]%l %l %l %l%g %CMEM %cUsage: MaXRSS %W$0 %cShMem %W$1 %cData %W$2 %cStack %W$3%l %l %l%g| %CSwaps %W$[-8]0 %CReclaims %W$[-8]1 %CFaults %W$[-8]2%l %l%K %CBlock %K[%cin %W$[-8]0 %cout %W$[-8]1%K]%K: %CMsg %K[%cRcv %W$[-8]0 %cSend %W$[-8]1%K]%K. %CSignals %W$[-8]0 %CContext %cVol. %W$[-8]1 %cInvol %W$[-8]2gEm=s5y%y-smg%.% %.%))*..*CLEARAUTONo Help Available for this command%WNo Help available for this command%d %d %s %s%s: [%d mins]Auto-Away after %d minsmsg.logtcl.log%I:%M%p[%s] %sa+%s %s/%c%cr%s %s %d %s%s %s %s %d%s %s %dNo active splitshopsuplinkservertime%s %s %s %sisareThere %s %d split serversNo split servers found*PRIVMSGPRIVMSG %s :%sKILL %s :%s%s %s %sKICK %s %s :%sTOPIC %s :%s!! %sWALLOPS :%sNOTICE %s :%sRELCR%s %s %s %s %sRELCRELDRELIRELMRELNRELSMRELSNRELSTRELSWRELSRELTRELWNo such msg #%d for /%s received%2d %s-list-kick-wall-wallop-msg-notice-topic-kboot-kill-ansi-helpCan not %s what you requestedWALLMSG NO Wallmsg included[BX-Wall/%s] %sNOTICE%s %s :%sExcluded <%s> from wallmsgIncluded <%s> in wallmsg$G No ops on $0No Current Channel for this Window.You must set the MSGLOGFILE and CTOOLZ_DIR variables first!You're not on a channel!You're not opped on %sreasons%s/%s.%serrorquit$0 has no reasonError looking up %s for %s@%s%s!%s %s is %s (%s)Error looking up %s%s is %s (%s)@comedunet.Remote closed connectionInvalid @host or user@host.Finger connect error on %s@%s No information for %sUsing WhoWas info for %s of %s No match for user %s+HOST*!*@%s ALL -CRAP -PUBLIC+USER*%s@%s ALL -CRAP -PUBLIC-USER-HOST*!*@%s%s!%s@%s%s NONEUnignored %s!%s@%sNo Match for ignorance of %s%s ^IGNORE %s NONETIMERNow ignoring ALL except CRAP and PUBLIC from %sPART %sJOIN %s%s%sChecking tables...~/%swhideme mynameis %s You must specify a nick and usernameYou must specify a username.%s@%sLaunching finger for %s (%s)IGHIGUNIGHUNIG%s %d*!*@*-opsCHOPS-nonopsNOPS-nkill-statsNo message givenpublicsnickskicksdopsNickNick dops kicks nicks publics%s!%sKILL %s :%s (%i%s %d %d %d %d%-10s %4d %4d %4d %4dUserHost+oChannelprotaopLevel%s %s %s %s %s %s %s%d %s %s %s %cvn/a No match of %s on %sThere are no [%s] on %sEnd of UserList on %s %d counted??%BO#%sGenerating irc server mapLINKSMAPLLOOKWait until previous %s is done> %K[%G$0%K]$G %%W$[-%d]1%%c $0 %sADAndorraAEUnited Arab EmiratesAFAfghanistanAGAntigua and BarbudaAIAnguillaALAlbaniaAMArmeniaANNetherlands AntillesAOAngolaAQAntarctica (pHEAR)ARArgentinaASAmerican SamoaATAustriaAUAustraliaAWArubaAZAzerbaijanBABosnia and HerzegovinaBBBarbadosBDBangladeshBEBelgiumBFBurkina FasoBGBulgariaBHBahrainBIBurundiBJBeninBMBermudaBNBrunei DarussalamBOBoliviaBRBrazilBSBahamasBTBhutanBVBouvet IslandBWBotswanaBYBelarusBZBelizeCACanada (pHEAR)CCCocos IslandsCFCentral African RepublicCGCongoCHSwitzerlandCICote D'ivoireCKCook IslandsCLChileCMCameroonCNChinaCOColombiaCRCosta RicaCSFormer CzechoslovakiaCUCubaCVCape VerdeCXChristmas IslandCYCyprusCZCzech RepublicDEGermanyDJDjiboutiDKDenmarkDMDominicaDODominican RepublicDZAlgeriaECEcuadorEEEstoniaEGEgyptEHWestern SaharaEREritreaESSpainETEthiopiaFIFinlandFJFijiFKFalkland IslandsFMMicronesiaFOFaroe IslandsFRFranceFXFrance, MetropolitanGAGabonGBGreat BritainGDGrenadaGEGeorgiaGFFrench GuianaGHGhanaGIGibraltarGLGreenlandGMGambiaGNGuineaGPGuadeloupeGQEquatorial GuineaGRGreeceGSS. Georgia and S. Sandwich Isls.GTGuatemalaGUGuamGWGuinea-BissauGYGuyanaHKHong KongHMHeard and McDonald IslandsHNHondurasHRCroatiaHTHaitiHUHungaryIDIndonesiaIEIrelandILIsraelINIndiaIOBritish Indian Ocean TerritoryIQIraqIRIranISIcelandITItalyJMJamaicaJOJordanJPJapanKEKenyaKGKyrgyzstanKHCambodiaKIKiribatiKMComorosKNSt. Kitts and NevisKPNorth KoreaKRSouth KoreaKWKuwaitKYCayman IslandsKZKazakhstanLALaosLBLebanonLCSaint LuciaLILiechtensteinLKSri LankaLRLiberiaLSLesothoLTLithuaniaLULuxembourgLVLatviaLYLibyaMAMoroccoMCMonacoMDMoldovaMGMadagascarMHMarshall IslandsMKMacedoniaMLMaliMMMyanmarMNMongoliaMOMacauMPNorthern Mariana IslandsMQMartiniqueMRMauritaniaMSMontserratMTMaltaMUMauritiusMVMaldivesMWMalawiMXMexicoMYMalaysiaMZMozambiqueNANamibiaNCNew CaledoniaNENigerNFNorfolk IslandNGNigeriaNINicaraguaNLNetherlandsNorwayNPNepalNRNauruNTNeutral Zone (pHEAR)NUNiueNZNew ZealandOMOmanPAPanamaPEPeruPFFrench PolynesiaPGPapua New GuineaPHPhilippinesPKPakistanPLPolandPMSt. Pierre and MiquelonPNPitcairnPRPuerto RicoPTPortugalPWPalauPYParaguayQAQatarREReunionRORomaniaRURussian Federation (pHEAR)RWRwandaSASaudi ArabiaSbSolomon IslandsSCSeychellesSDSudanSESwedenSGSingaporeSHSt. HelenaSISloveniaSJSvalbard and Jan Mayen IslandsSKSlovak RepublicSLSierra LeoneSMSan MarinoSNSenegalSOSomaliaSRSurinameSTSao Tome and PrincipeSUFormer USSR (pHEAR)SVEl SalvadorSYSyriaSZSwazilandTCTurks and Caicos IslandsTDChadTFFrench Southern TerritoriesTGTogoTHThailandTJTajikistanTKTokelauTMTurkmenistanTNTunisiaTOTongaTPEast TimorTRTurkeyTTTrinidad and TobagoTVTuvaluTWTaiwanTZTanzaniaUAUkraineUGUgandaUKUnited KingdomUMUS Minor Outlying IslandsUSUnited States of AmericaUYUruguayUZUzbekistanVAVatican City StateVCSt. Vincent and the grenadinesVEVenezuelaVGBritish Virgin IslandsVIUS Virgin IslandsVNVietnamVUVanuatuWFWallis and Futuna IslandsWSSamoaYEYemenYTMayotteYUYugoslaviaZASouth AfricaZMZambiaZRZaireZWZimbabweCOMInternic CommercialEDUEducational InstitutionGOVGovernmentINTInternationalMILMilitaryNETInternic NetworkORGInternic Non-Profit OrganizationRPAOld School ARPAnetATONato FielMEDUnited States MedicalARPAReverse DNS   #+.CFMPcfps "%+.69KNVY`cknux"(+47=@ILWZpsx{$'69ADJMVYadil} "%,/69DGY\cf %(/28;Z]bejmux~ '*58=@HKWZhkux '*03LOZ]hkvy $+.47=@UX]`lotw~  !*-36>AILgjqt!$/2:=EHQTjm &)14:=HKRUilsv}:=GJadvy7;FJX\eiz~unknownmodules.cDLL [%s%s%s] installedCommand %10s %sAliasHookCtcpVariableNo modules loadedLoadDllModule [%s] Already installed_Initcouldn't load file: %s %sUnSuccessful module load%s_Version%s_CleanupError module version [%s]Error initiliziing module [%s]%3.3u%s %d$G Successfully removed [$0 ($1)]%s$G Unsuccessful module unloadNo such module loaded @*names.coper_view %dl +l-lk+k-ki+i-in+n-ns+s-st+t-to+o-ov+v-vb+b-b%s%s*.*.*%s %s%s %s %s%sPress Ctrl-F to see who left Ctrl-E to change to [%s]KICK %s %s :Niq flood (%d nicks in %dsecs of %dsecs)MODE %s -o+b %s %s!*@*KICK %s %s :Lame Nick detected %s %c%s (%s) (Win: %d): %s!Current channel %sNo current channel for this windowOther servers:You are not on any channelscurchanJOIN %s%s%s%s %1.3fJoin to %s was synced in %1.3f secs!!MODE %s %s%u.%u.%u.%u%d.%d.%d.%dnewio.c***XXX*** Buffer for des [%d] is filled!FD [%d], should [%d] did [%d]Aberrant condition for des [%d], closing down the connection out of desperation.des [%d] passed to dgets(), but it isnt ready.X*X*X*X*X*X*X*X*X ABANDON SHIP! X*X*X*X*X*X*X*X*X*Xwrite_pos is zero when it cant be.But something is buffered. Flushing it to see if that helps.*** Too many read()s on des [%d] without a newline!new select called before io_rec init*** Notice -- *** Notice -- Received KILL message for .%s %s %s %s%sNick collision onNick change collision onchange%s %sIP# Mismatch:IP Mismatch %C$1-Hacked ops on opless channel:Hacked ops on $0connect failure:Connect failure %K[%n$0-%K]Identd response differsIdentd response differs %K[%C$1-%K]Fake: %s %s %sUnauthorized connection fromToo many connections fromEntering high-traffic mode -still high-traffic mode -EnteringResuming standard operation% is rehashing Server config*% added K-Line for *from%s %s %s %s %sRejecting vlad/joh/com bot:Rejecting eggdrop bot:Rejecting ojnk/annoy botPossible bot Possible % bot *Unknown% % is now operator*Received SQUITSQUIT of $1 from $2 %K[%R$3-%K]WALLOPS :Remote CONNECTRemote Connect of $1:$2 from $3Client connectingClient exitingconnectTerminating client for excessInvalid username:STATS Nick flooding detected by:Nick Flooding %K[%B$1-%K]Kill line active forK-line active forKillKill line for $1 active*** Notice --MOTD %s *** %s***[*Wall*notice.cbxglobalLOAD2.8mumeu2.9u2.10u3.0%s %dCRAPACTIVEKNICKSTATSUSERFLOODCONNECTSERVERSQUITOPERBOTSKLINEREHASHTRAFFICCLIENTSUNAUTHSFAKESIDENTDHACKMISMATCHKILLSCOLLIDE,ALLNONE$G %bOper%BView%n: $0-$G Try connecting to a server firstYou must specify from the following: %swsckfoper_viewMODE %s -%s%sMODE %s +%s+HIDE-HIDEHIDEGROW$G %BOper%bView%n is %K[%W$0%K]$G %BOper%bView%n is now toggled %K[%W$0%K]$G %BOper%bView%n is already %K[%W$0%K]%s notify.c%u %s$G Online UsersLast seenPeriodTimesUserHostNick%s %s %s %s %snowunknown@unknown$G Offline Usersn/anonenever@%s removed from notification list%s is not on the notification listNotify list clearedWildcards not allowed in NOTIFY nicknames!%s added to the notification list*Auto-inviting %s to %sNOTICE %s :Auto-invite from %sINVITE %s %s%s%s%s %s%s %s %sNOTIFY %s Notify %dSaved %d Notify entriesOLDQUIETNOISY%3.3unumbers.cL:line $[20]left($rindex([ $1) $1) :$[-5]2 $[-5]3 $[-6]4 $[-5]5 $[-6]6 $[-8]strip(: $7) $strip(: $8)$[8]9 $[30]mid(${rindex([ $1)+1} ${rindex(] $1) - $rindex([ $1) + 1} $1)$[10]1 $[-10]2 $[-10]3$1:line $[25]2 $[25]4 $[-5]5 $[-5]6$1:line $[25]2 $[20]4 $3$1:line $[-5]2 $[-6]3 $[-6]4 $[-6]5 $[-10]6$1:line $2-%G$0%n has been up for %W$3-$1:line $[25]2 $[9]4$1:line $[25]2 $[25]4%s %s%s%s %s %s)(from %s %s%s%s%s%s%s%s %s %s %l (Channel is temporarily unavailable) (Channel is full) (You must be invited) (You are banned) (Bad channel key) (Bad channel mask)%3.0f%d %s$G %K[%nlocal users on irc%K(%n$0%K)]%n $1%%$G %K[%nglobal users on irc%K(%n$0%K)]%n $1%%$G %K[%ninvisible users on irc%K(%n$0%K)]%n $1%%$G %K[%nircops on irc%K(%n$0%K)]%n $1%%%d$G %K[%ntotal users on irc%K(%n$0%K)]%n$G %K[%nunknown connections%K(%n$0%K)]%n%d %d$G %K[%ntotal servers on irc%K(%n$0%K)]%n %K(%navg. $1 users per server%K)$G %K[%ntotal channels created%K(%n$0%K)]%n %K(%navg. $1 users per channel%K)$G %K[%nHighest client connection count%K(%n$0%K) %K(%n$1%K)]%nB$G Your nick %R[%n$0%R]%n is owned by %W$1@$2For more information about BitchX type /aboutMODE %s %s, JOIN %s%s%sChannelUsersTopic322 crash attempt from hacked server %s%s %s %s %s%s %s has invited %s to channel %sOdd Server stuff from %s: %s464 crash attempt from hacked server %sPassword required for connection to server %sServer Password:465 crash attempt from hacked server %s%s %s %s %s %s%d %s %s %s %lunknown%s %d %s%s Total Number of Bans on %s [%d]WHO -server %s %s%s %s from (%s)%s Your user mode is [%s]%lu%s Channel %s was created at %sServer %s %s %s%s %-20s %-20s %s%s %-20s %s(U(B(0)0%s %s: %sOPER_VIEWparse.c--- Fake Message recieved!!! ---autokick for boldKICK %s %s :%sautokick for beepingautokick for mirc colorautokick for underlineautokick for inverseautokick for CAPS LOCK0000027fedMODE %s -o+b %s *!*%sZmodem rocks%d %s *!*%s%sBitchX BWK: KICK %s %s :%s %sTOPIC %s :%s%s %s %s%s %s %s %sS*%s %c %s!%%-%u.%us %%-9s %%-3s %%s@%%s (%%s)%s %-9s %-3s %s@%s (%s)@Channel%s %s %s %s %s %s %sNOTICE %s :%s is ignoring youPUBLIC%s %s %s %s %smsgNOTICE %s :*%s* %s%s %sOnOff%l %l %sNOTICE %s :%s?*.*%s: PONG received from %sLAG%2.4f$G Server pong from %W$0%n $1 seconds%s: PING received from %s %s (+o) (+v)WHO %s MODE %s MODE %s b WHO %s%s %s %s %dUnKnown%s %s %s %s %s %sMODE %s -o+b %s %s!*KICK %s %s :Lame Nick detected%d %s %s!*Press Ctrl-K to join %sJOIN %s %s%c %s+%i %dServer [%s] has rejected you (probably due to a nick collision)+%i(No Reason Given)Killed by %s (%s)You have been KilledPONG %s-MODE %s %co %s%.%%s %s %c%c %s%s %s %c%c(no comment)NICK %s JOIN %s%s%sMODE %s -o %sKICK %s %s :Mass kick detected - (%d kicks in %dsec%s)Odd server stuff: "%s %s" (%s)Odd server stuff: "%s %s"PINGPONGKILLSILENCEERROR:ERRORWALLOPSINVITEKICKTOPICNICKNOTICEQUITMODEPARTJOINPRIVMSGDEBUG_MSG: %10s[%03d/%03d/%03d] # %ld -> %ld bytesDEBUG_MSG: Total bytes recieved %ldv* %sTopNO_FLUSHSHOWLISTDODELETEFLUSHQUEUE: (%s) no such queueQUEUE: missing closing braceQUEUED: %s now has %d entriesqueue.c QUEUEQUEUE: No more queues<%s:%2d> %s<%s> End of queue%s/%sreadlog.cError unlinking: %sRemoved %s.MORE-r%sr%s Error Opening Log file %sDelete msg log [y/N]? *** Hit any key for more, 'q' to quit ***%u %sThis is not a scratch window.scratch_line is too big.screen.cBeep in window %dActivity in window %d %-*sCant scroll this window![%ldm[%d;%dmscreen%dx%dXTERMrxvt-geometry-e/usr/local/bin/wservlocalhostDISPLAYTERMI don't know how to create new windows for this terminalSTYwoundwindowOpening new %s...Couldnt establish server side -- error [%d]I couldnt fire up a new wserv processsignaledexitedchild %s with %dErrno is %dr+You may not kill the main screenThe screen is now dead.BitchX exiting on EOF from stdinBitchX - EOF from stdinHey! Where'd my controlling terminal go?]2;BitchX: %s on %s:%sabcdefghijklmnopqrstuvwxyzserver.cClosing server %d because [%s]QUIT :%s Servers exhausted. Restarting. [%d]Remote end closed connectionConnection closed from %s: %sConnection to server %s resumed...Unable to connect to a server%s %s%sNo ConnectionNo connectionConnection to server %s lost.[%d] <- [%s]Deleting server [%d]Sorry, the server list is empty and I just dont know what to do.new_des is %dunknown hostUnable to connect to port %d of server %s: %sConnecting to refnum -1. That makes no sense.Connecting to port %d of server %s [refnum %d]changing serversPASS %sConnected to port %d of server %sNo Server ListYou are not connected to a server. Use /SERVER to connect.rIRC_SERVERS_FILEircII.servers%s%s~/%s.Current server: %s %dCurrent server: Primary server: %s %dPrimary server: Server list:[%s]unknown %d) %s %d %d) %s %d (was %s) %d) %s %d (%s)The server list is empty-DELETENo such server in listCan not delete server that is already openNeed server number for -DELETE-ADDNeed server info for -ADDYou can't close your primary server!closing serverYou are not connected to a server.OnOff%s [BX-MsgLog %s] %sPRIVMSG %s :ACTION %sAWAY%s :%s%K %W$N%nAWAY :USER %s %s %s :%s [%d] -> [%s]%d %d %sWrite to server failed. Closing connection.No Connection to %dWarning: server_list[%d].itsname is null and it shouldnt beNo such server!DisconnectingThat server isn't connected!Connection Closed.Disconnecting from server%s %s %sNICK %s_You have specified an illegal nicknamePlease enter your nicknameNickname: ON stack is empty!Missing event type for STACK ONNumerics must be between 001 and 999No such ON function: %s%3.3ustack.cNo %s on the stackLevel %d stackThe STACK ON %s list is emptyUnknown STACK ON type ??PUSHPOPLIST%s is unknown stack verbStackONALIASASSIGNSET%s is not a valid STACK type%R%I:%M%p%02d:%02d%ld%sstatus.c%%*s%sv%d %d %s No Server,*private*%2d??No Topic%dcpu(%d-%d)TERMirc: No TERM variable found! irc: Current TERM variable for %s has no termcap entry. colisgcmclcrnlcendlebssfsrcsALDLicimeidcsoseusuemdmeblmbaldl  Your terminal cannot run IRC II in full screen mode. The following features are missing from your TERM setting. Cursor Movement Clear Screen Clear to end-of-line Cursor right Cursor left Scrolling Try using VT100 emulation or better. D%s: Need a timer reference number for -DELETEAREP%s: Missing argument to -REPEAT*-1REF%s: Missing argument to -REFNUMLW%s: That window doesnt exist!UPDATE%s: %s no such flag%s: To use -UPDATE you must specify a valid refnumTIMERtimer.c(Timer) Error for '%s': %s%u %s timer%lu%s: No commands pending to be executedCommandEventsSecondsTimer%s %s %s %s%s(internal callback)%s %l %d %sYou may not remove a TIMER from itselfTIMER: Can't delete %s, no such refnumTIMER: Refnum %s already existsuser.cTier1[%d] %d %d %s %sTier2[%d] %d %d %s %sTier3[%d] %s %sTier1 = [%d] Tier2 = [%d] Tier3 = [%d]BOTFLOODI_OPSKILLDCCINVITEUNBANBANOPSVOICEPINVITEPBANKICKDEOPREOPFRIENDMASTEROWNER,userlist.cNo such nick [%s] found*!*%s@%s%s@%sNOTICE %s :You have been added to my Userlist as *!%s with [%s]NOTICE %s :You are allowed on channels [%s]NOTICE %s :Your password is [%s]None%s %s %s %s$G Added [*!$0] on $1. Password is [$2] and flags are [$3-]%sUser not found on the userlist%s %s$G Removed [$0] on $1 from userlistUNUSER-ALLRemoving all Users on Userlist-PPPUnUserAddUserNeed a channel for %sOPS,VOICE,INVITE,UNBAN,FLOOD,REOP,DEOP,AddingDeleting%s %s!%s to Userlist%d %d %s %sUNSHITRemoving all Users on shitlistUnShitAddShitShitListz%d %d %s %s%s!%sAdding %s to Shitlist%s already on my ShitlistDeleting %s from ShitlistDidnt find %s on %s ShitlistChannelsHostPasswordNickLevel%s %s %s %s %s%d %s %s %s %s%s %dNo entries in Shit listReasonLvl%s %s %s %s %s %s%d %s %s %s %s %s%D %J[%u:%a:%f:%b:%h]BitchX by panasync [DCC gets/%& sends/%&][CDCC gets/%| offer/%|] (zZzZ %A)%C@%T (%J) -- more -- (%B)[Lag %L][Mail: %M](+%+) Aw[%^]*+%N [Act: %F][nk/%K ok/%K](overtype) [Query: %Q] via %S%-(+%#) * type /help for help [O/%! N/%! I/%! V/%! F/%!]^^^^^^^^ (Scroll)+iwMSGSKILLS,CLIENTS,TRAFFIC,REHASH,KLINE,BOTS,OPER,SQUIT,SERVER,CONNECT,FLOOD,USER,STATS,NICK,ACTIVEK Keep it to yourself!*fuck* *shit* *suck* *dick* *penis* *cunt* *haha* *fake* *split* *hehe* *bogus* *yawn* *leet* *blow* *screw* *dumb* *fbi*%GC%gDCC%G[$0]tcl.log/usr/local/lib/irc/helpswfckValue must be either ON, OFF, or TOGGLEValue of %s set to %s%s %s%sValue of %s set to '%c'Value of %s must be a single character%s %cValue of %s must be numeric!Value of %s must be greater than 0Value of %s set to %d%s %dSET: no such userSet stack is empty!No such Set [%s]Set is ambiguous %sSet%s is not on the %s stack!Variable [%s] = %sVariable [%s] = %dVariable [%s] = %cError in do_stack_set: unknown set typeUnknown STACK type ??FORMAT-FORMAT %s%s%sNo such variable "%s"%s is ambiguousSET %s %s %s %c %s %u -%s Saved %d variablesWarning! You have turned EXEC_PROTECTION offPlease read the /HELP SET EXEC_PROTECTION documentationWarning! You have turned INPUT_PROTECTION offPlease read the /HELP ON INPUT, and /HELP SET INPUT_PROTECTION documentationWarning! Your terminal says it does not support eight bit charactersAuto Response is set to - %swhois.c+-%s %s %s %s %s (away) (Is an IRC operator)%s %s is %s@%s%s%s%s %s %s %s %s %s%s%s %s %s %s%s@%s*%s %s%d %s %s %sAllowed:Not-Allowed:%s %s %s (is NOT an IRC warrior) is an IRC Server Administrator is a Services Administrator looks very helpful. is a registered nick%d %d %d %sWHOWAS %s %dWHOWAS %s@NOTICE %s :%s is ignoring you. JOIN %s%s%sISON %sUSERHOST %sWHOIS %s + - + - USERHOSTwhowas.c%s!%sUserlistReglistSplitin%sONOFFwindow.c%dYou can't kill the last window!%udisplay_buffer size is %d. should be 0%sNot enough room for another window!This window is not on a screenThe window to be swapped in does not exist.You can only SWAP a hidden window with a visible window.%d %dYou cannot change the size of hidden windows!Can't change the size of this window!Not enough room to resize this window!GOTO: Illegal valueYou can't hide an invisible window.You can't hide the last window.Maximum lines that may be scrolled is %d Hidden%-4s %*.*s %*.*s %*.*s %-9.9s %-10.10s %s%s%s: No such window: %s%s: Please specify a window refnum or nameLAST%s: There are no hidden windows%s: Window %s is not hidden!%s: Window %d is not hidden!%s: Please specify a window refnum or LAST%s: %s%s: You must specify the number of linesValue for %s must be ON, OFF, or TOGGLEWindow %s is %sADD: Add nicknames to be redirected to this windowAdded %s to window name list%s already on window name listBEEP_ALWAYSBIND: %s is not a valid channel nameWindow is already bound to channel %sYou may only /WINDOW BIND the current channel for this windowWindow is bound to channel %sCurrent channel for window now %sWindow is not bound to any channel-iYou have not been invited to a channel!Channel %s is already bound elsewhereYou are now talking to channel %sJOIN %sCannot create new screen!Window %s (%u)Window %u Server: [%d] %s Screen: %p Geometry Info: [%d %d %d %d %d %d] CO, LI are [%d %d] Current channel: %s Waiting channel: %s Bound channel: %s Query User: %s Prompt: %s Second status line is %s Logging is %s Logfile is %s No logfile given Notification is %s Hold mode is %s Window level is %s Lastlog level is %s Notify level is %s Name list: %sDOUBLESPLITAlready a split windowTRIPLEFIXEDGOTOGROWHOLD_MODEThere are no hidden windows!Lastlog size is %dLastlog level is %sWindow level is %sLevelServerQueryChannelNameNickRefLOG.Window_Window LOGFILE set to %sWindow LOGFILE is %sWindow LOGFILE is not set.MOVE%s is not unique!You must specify a name for the window!There are no hidden windowsNotification when hidden set to %sWindow notify level is %sWindow number must be greater than 0Window number missingThe window stack is empty!You must specify a prompt for the window!-cmdEnding conversation with %sYou have not messaged anyone yet,You have not recieved a message yet*You are not on a channelStarting conversation with %sREFNUMNo such window!Removed %s from window name list%s is not on the list for this window!REMOVE: Do something! Geez!SERVER: You must specify a serverSHOWSCRATCHSCROLLBACKWindow scrollback size set to %dSKIPSHRINKSIZEWindow stack:SWAPChannel %s is no longer boundChannel %s is not bound - Updates the window status on all windowsUPDATE[#channel] - Removes a channel bound to a window. If not specified then the current channel is usedUNBIND[on|off|toggle] - Turns on/off/toggle a triple status bar[refnum] - Swap the current window with the specified hidden [refnum] window - Shows the current window stack which have been added using /window pushSTACK[on|off|toggle] - Places a third status line at the top of the screen if possible on/off/toggle[on|off|toggle] - Set's the current windows skip status on/off/toggle[lines] - Set's the current window to # lines[lines] - Shrinks the current window by # of lines - Makes all hidden windows visibile againSHOW_ALL[refnum] - Makes the specified [refnum] window visible again[lines] - Sets the scrollback size for this window - Create a scratch window. this window has no scrollback or scroll[text] - Displays or sets window specific set'sSET[servername[:[][:[][:[]]]]] - Attempts to connect current window with a new serverSERVER[nick|#channel|nick1,nick2,...] - Removes nick|#channel from this window's displayREMOVE[refnum] - Changes the current window to [refnum]Adds/remove query for current windowQUERY[refnum] - Places the current window or specified window on the window stackPUSH[text] - Sets the current input prompt to [text]PROMPT - Sets the current window to the previous numbered windowsPREVIOUS - Pops the top window off the window stack. if hidden it's made visiblePOP[number] - Set's the current windows refnum to #NUMBER[level] - Set's current window notification level to [level]NOTIFY_LEVEL[on|off|toggle] - Turns notification on/off/toggle for the current window.NOTIFY - turns the server off for this windowNOSERV - Sets the current window to the next numbered windowNEXT - Creates a new windowNEW[text] - Sets the name for the current windowNAME[number] - Moves the current window on the display [number] of times[filename] - Sets the filename for the current windows logfileLOGFILE[on|off|toggle] - Turns window logging on/off/toggle - Displays a list of windowsLIST[level] - Sets the window's level to [levels]LEVEL[level] - Sets the current windows lastlog level to [levels]LASTLOG_LEVEL[number] - Sets this windows lastlog size to #LASTLOG - Places you in the last window you were in - Swaps the current window with the last one hidden and kills the swapped out windowKILLSWAP - Kills all visible windows except the current oneKILL_OTHERS - Kills the current windowKILL[on|off|toggle] - Sets the current window's hold mode status - Hides all windows except the current oneHIDE_OTHERS - Hides the current windowHIDE- All of this commands work on the current windowHELP[number] - Grows the current window by # of lines[refnum] - Go's to a N'th window[on|off|toggle] - Turns fixed window sizing on/off/toggle[text] - echo [text] which is in quotes to a windowECHO[on|off|toggle] - Turns double status bar on/off/toggleDisconnects window from a serverDISCON[text] - Displays useful information about the current windowDESCRIBE - Used to kill a screen (wserv) in X-windowsDELETE - Create a new screen using wserv in X-windowsCREATE[#channel|#chan1,#chan2,...] - Attempts to join a channel in current windowCHANNEL[#channel] - Binds a channel to a windowBIND[on|off|toggle] - Should this window beep always on/off/toggle - Balances the displayed windowsBALANCE - Moves you back one windowBACK[nick|#channel|nick1,nick2,...] - Adds [nick|#channel|nick1,nick2,...] to the nicks to display in a windowADD $G $[13]0 $[13]1 $[13]2 $[13]3 $[13]4%R[%ncommand%R]%n to get help on specific commandsWINDOW helpWINDOW %s - No help available$G WINDOW - No such commandWINDOW: Invalid option: [%s]error in delete_display_lineerf. fix this.words.cwrong # args: kill a client. Needs Userlevel KILLdie"wrong # args: should be "tcl.c%d %sNo bots linkedNo dcc chats ?args? %s %s %suserhostun-userhost%s channel|nick ?args?noticeNOTICEPRIVMSG target ?args? channel not on that channel nick format time error with strftime ?args?set ircii %s channel mode ?arg?invalid channel: invalid mode: modes b/v/o require an argument nick!user@host nickname channel%d %s %d %d%s %d %lu %s %d %d %d %lu %lu %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %lu %d %lu %d %lu %d %lu %d %lu %d %d %d %d %d %d %d %lu %d %d %lu %d %d command ?options?add add channel-name ?options? channel error in [channel]JOIN %s %sset set channel-name ?options? no such channelinfo info channel-nameremove remove channel-namePART %sadd, set, info, removeunknown channel command: should be one of: no such nick: illegal channel: handle*%d %s%s%s%d %s %s nickname level nick channel unixtimeOfferedUnknownWaitingActiveClosed%d %d %s %s %s %lu %lu %lu %lu %lu %s %s channel invalid channel:nickname channel text level channel textlevel out of range (must be 1-5)%lu hand idx text botnick messagechatuser is not connectedzapf %s %s %s messagezapf-broad %s %s Tcl error [%s]: %s*%s minutes commandtime value must be positive, nonzerotimer%s%s asked me to die%s Requested we dieRequested DIE limitlimit must be greater than 0 seconds command timerIDtimerargument is not a timerIDinvalid timerID_n_uh_h_a $_n $_uh $_h $_a(%s!%s) !%s! %s %s_i $_n $_i $_a_aa_aaa $_n $_uh $_h $_a $_aa $_aaa $_n $_uh $_h $_a $_aa%s %s%s%s%s $_a $_aa%s %s!%s $_a%s_help $_n $_a $_aa $_n $_h $_amsgdccfilpubmsgmpubmjoinpartsignkicktopcmodectcpctcrnickrawbotchonchofsentrcvdlinkdiscspltrejnfiltcmdinputaliashelpfunchook type flags cmdName procNamesplt, rejn, filt, cmd, raw, input, alias, help, func, hooknick, bot, chon, chof, sent, rcvd, chat, link, disc, msgm, pubm, join, part, sign, kick, topc, mode, ctcp, bad type, should be one of: dcc, msg, fil, pub, no such bindingTCL Command bindings: TYPE FLGS COMMAND BINDING (TCL) %-4s %-16s %-20s %sNo TCL command bindings.No bindings for %s.invalid keyed list format: list contains an empty field entryinvalid keyed list format: list contains an empty field namefield "field name scoping: no value associated with invalid keyed list format or inconsistent trailing data following value in field: "invalid keyed list format: null key not allowedempty field namefield name not found: " listvar key listvar ?key? ?retvar | {}?" not found in keyed listkey " listvar ?key? listvar key value ?key value...?-exact-glob-regexp": must be -exact, -glob, or -regexpbad search mode " ?mode? list pattern"endlen%ld var ?indexExpr? ?string? list%dirciivaliduserpushmodeflushmodelvarpoplemptylmatchkeyldelkeylgetkeylkeyskeylsetmaskhostonchansplitserverschanstructchannelchannelsisopgetchanhostmatchattrfinduserfindshitdategetcommentsetcommenttimectimedccstatsonchanchanlistunixtimeputlogputloglevrandkilltimerutimerkillutimertimersutimersputservputscrputdccputbotputallbotsbindbindsunbindstrftimecparsegetchanmodesaydescbotsclientsrwordbotnickrealnameusernamecurchanservernoneversionBitchX Tcl Interpreter %GVersion $1%n (c)1997 Colten EdwardsfileTcl: [%s]xechoonoffTcl: xecho %sTcl: unknown cmd [%s]Tcl: %s %sTcl: [%s] %s<-version | -file filename> tclEr n bt f \\Virtual memory exhausted. tc=li#co#/etc/termcapTERMCAPrtgetent: loop detected, check your termcap tgetent: warning: termcap entry too long virtual memory exhausted NULL argumentregexp too bigout of spacetoo many ()unmatched ()junk on end*+ operand could be emptynested *?+invalid [] rangeunmatched []internal urp?+* follows nothingtrailing \^$.[()|?+*\internal disasterNULL parametercorrupted programmemory corruptioncorrupted pointersinternal foulupsourceexecunsupported0vwaitupdatetimetellsocketseekreadpwdputspidopenglobgetsflushfilefconfigurefblockedeofclosecdafterwhileupvaruplevelunsettracetclswitchsubststringsplitsetscanreturnrenameregsubregexpprocpackagelsortlsearchlreplacelrangeloadllengthlistlinsertlindexlappendjoininterpinfoincrifhistoryglobalformatforeachforfileeventexprexitevalerrorcontinueconcatclockcatchcasebreakarrayappend%g7.5p1+tcl_patchLevel7.5tcl_versiontcl_precisionTclAssoc Data Key #%dDeleteInterpProc called with active evalsDeleteInterpProc called on interpreter not marked deletedtkerrorbgerrortoo many nested calls to Tcl_Eval (infinite loop?)attempt to call eval in deleted interpreterIDELETECORE...unknown"invalid command name "invoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %d ... while executing "%.*s%s" invoked from within "%.*s%s"errorInfoNONEerrorCodeunable to alloc %d bytesunable to alloc %d bytes, %s line %dunable to realloc %d bytesunable to realloc %d bytes, %s line %d option ?arg ...?"wrong # args: should be "clicks clicks"wrong # arguments: must be "%luformat%a %b %d %X %Z %Y format clockval ?-format string? ?-gmt boolean?wrong # args: -format-gmt": must be -format or -gmtbad option "scan scan dateString ?-base clockValue? ?-gmt boolean?-base": must be -base or -gmt"unable to convert date-time string "seconds seconds"": must be clicks, format, scan, or secondsunknown option "integer value too large to representIOVERFLOWARITHexpected unsigned time but got "bad format string"wrong # args: should be " string ?in? patList body ... ?default body?"inextra case pattern with no bodydefault ("%.50s" arm line %d) command ?varName?"couldn't save command result in variable%d dirName"~ message ?errorInfo? ?errorCode?"errorCode arg ?arg ...?" ("eval" body line %d) ?returnCode?" option name ?arg ...?"dirname:.tailrootnameextensionpathtypeabsoluterelativevolumerelativesplitjoinreadable01writableexecutableexistsatime%ldisdirectoryisfilelstat lstat name varName"": couldn't lstat "mtimeownedreadlinkcouldn't readlink "size%lustat stat name varName"couldn't stat "typeor writableroot, size, split, stat, tail, type, lstat, mtime, owned, pathtype, readable, readlink, extension, isdirectory, isfile, join, ": should be atime, dirname, executable, exists, bad option " name"devinomodenlinkuidgidctimefiledirectorycharacterSpecialblockSpecialfifolinksocketunknown start test next command" ("for" initial command) ("for" body line %d) ("for" loop-end command) varList list ?varList list ...? command"couldn't set loop variable: " ("foreach" body line %d) formatString ?arg arg ...?"format string ended in middle of field specifierbad field specifier "%c"cannot mix "%" and "%n$" conversion specifiers"%n$" argument index out of rangenot enough arguments for all format specifiers" argumentwrong # args: no expression after "thenwrong # args: no script following "elseifelsewrong # args: no script following "else" argument varName ?increment?"wrong # args: should be " (reading value of variable to increment) (reading increment)%d option ?arg arg ...?"args args procname"" isn't a procedure"body body procname"cmdcount cmdcount"commands commands ?pattern?"complete complete command"10default default procname arg varname"" doesn't have an argument "procedure "couldn't store default value in variable "exists exists varName"globals globals ?pattern?"hostname hostname"levelbad level " level [number]"library library"tcl_libraryno library has been specified for Tclloaded loaded ?interp?"locals locals ?pattern?"nameofexecutable nameofexecutable"patchlevel patchlevel"tcl_patchLevelprocs procs ?pattern?"script script"sharedlibextension sharedlibextension".sotclversion tclversion"tcl_versionvars vars ?pattern?"whichsharedlibextension, tclversion, vars, or whichnameofexecutable, patchlevel, procs, script, exists, globals, hostname, level, library, loaded, locals, complete, default, ": should be args, body, cmdcount, commands, bad option " list ?joinString?" list index"end list index element ?element ...?" list" list first last"expected integer or "end" but got " list first last ?element element ...?"": must be integer or "end"bad index "list doesn't contain element -exact-glob-regexp": must be -exact, -glob, or -regexpbad search mode " ?mode? list pattern" ?-command string? list" ?-ascii? ?-integer? ?-real? ?-increasing? ?-decreasing?can't invoke "lsort" recursively -decreasing, or -command": must be -ascii, -integer, -real, -increasingbad switch "-ascii-command followed by comparison command"-command" must be-decreasing-increasing-integer-real (converting list element from string to integer) (converting list element from string to real) (user-defined comparison command)comparison command returned non-numeric result"wrong # args: should be "subMatchVar ...?" ?switches? exp string ?matchVar? ?subMatchVar -indices-nocase--": must be -indices, -nocase, or --bad switch "0-1 -1%d %dcouldn't set variable "1 ?switches? exp string subSpec varName"-all": must be -all, -nocase, or --%d oldName newName"": command doesn't existcan't delete "": command already existscan't rename to "tkerrorbgerrorcan't rename "-codeokerrorreturnbreakcontinuecontinue, or an integer": must be ok, error, return, break, bad completion code "-errorinfo-errorcode: must be -code, -errorcode, or -errorinfobad option " string format ?varName varName ...?"too many fields to scanfield width may not be specified in %c conversionunmatched [ in format stringbad scan conversion character "%c"different numbers of variable names and field specifiers%u fileName" string ?splitChars?" option arg ?arg ...?"compare compare string1 string2"-1first first string1 string2"index index string charIndex"last last string1 string2"length length string"match match pattern string"range range string first last"endexpected integer or "end" but got "tolower tolower string"toupper toupper string"trim string ?chars?" trimlefttrimrightwordend string index"wordstartwordend, or wordstartrange, tolower, toupper, trim, trimleft, trimright, ": should be compare, first, index, last, length, match, or -novariables": must be -nobackslashes, -nocommands, -nobackslashes-nocommands-novariables ?-nobackslashes? ?-nocommands? ?-novariables? string"-exact-glob-regexp": should be -exact, -glob, -regexp, or -- ?switches? string pattern body ... ?default body?"extra switch pattern with no bodydefaultno body specified for pattern " ("%.50s" arm line %d)appendarraycasecatchclockconcatevalexitexprfileeventforforeachformatglobalhistoryifincrinfointerpjoinlappendlindexlinsertlistllengthloadlrangelreplacelsearchlsortpackageprocregexpregsubrenamescansetsplitstringsubstswitchtraceunsetupvaruplevelwhileaftercdcloseeoffblockedfconfigurefileflushgetsglobopenpidputspwdreadseeksockettelltimeupdatevwaituplevel, upvar, vwait or whilesubst, switch, tell, trace, unset, update, rename, return, scan, seek, set, socket, split, string, package, pid, proc, puts, pwd, read, regexp, regsub, llength, load, lrange, lreplace, lsearch, lsort, open, info, interp, join, lappend, lindex, linsert, list, foreach, format, gets, glob, global, history, if, incr, exit, expr, fblocked, fconfigure, fileevent, flush, for, cd, clock, close, concat, continue, eof, error, eval, ": should be after, append, array, break, case, catch, command ?count?" ("time" body line %d)%.0f microseconds per iteration option [arg arg ...]"too few args: should be "variable variable name ops command"vdelete vdelete name ops command"vinfo{ vinfo name"} {": should be variable, vdelete, or vinfo": should be one or more of rwubad operations " r w u test command" ("while" body line %d)saturdayfridaythursthurthursdaywedneswednesdaytuestuesdaymondaysundaydecembernovemberoctoberseptseptemberaugustjulyjunemayaprilmarchfebruaryjanuarysecsecondminminutehourdayweekfortnightmonthyearepochagonextthislastnowtodayyesterdaytomorrowdstidlenzdtnzstnztgsteadteastcadtcastjstcctjtwadtwastzp6istzp5zp4itbteetfstfwtsstswtmestmewtmetcetidlwntahstcathdthstydtystpdtpstmdtmstcdtcstedtestadtastndtnstnftatwatbstwetutcutgmtzyxwvutsrqponmlkihgfedcbaama.m.pmp.m.yacc stack overflowsyntax errorenvEnvTraceProc called with confusing argumentsEnvTraceProc couldn't find interpreterTcl_DeleteModalTimeout found timeout stack corruptederrorInfoerrorCodetclBgErrorbgerror"bgerror" is an invalid command name or ambiguous abbreviation bgerror failed to handle background error. Original error: Error in bgerror: option ?arg arg ...?"wrong # args: should be "tclAfterafter#%dcancel cancel id|command"idle idle script script ..."info info ?id?"" doesn't existevent "timer": must be cancel, idle, info, or a numberbad argument "after# ("after" script) name"": would wait forevercan't wait for variable "idletasks": must be idletasksbad option " ?idletasks?"~!:?||&&|^&!===>=<=><>><<-+%/*76UNKNOWNEND,)(VALUEroundintdoubleabsinteger value too large to representIOVERFLOWARITH"unmatched parentheses in expression "unknown operator in expressiondivide by zeroDIVZEROcan't have : operator without ? firstsyntax error in expression " as operand of "floating-point valuenon-numeric stringcan't use %ldexpression didn't have numeric valueunknown math function "argument to math function didn't have numeric valueargument to math function didn't have integer valuetoo many arguments for math functiontoo few arguments for math functiondomain error: argument not in valid rangeDOMAINfloating-point value too small to representUNDERFLOWfloating-point value too large to representOVERFLOW%derrno = unknown floating-point error, vA?A^(([a-zA-Z]:)|[/\][/\]+([^/\]+)[/\]+([^/\]+)|([/\]))([/\])*///^((/+([.][.]?/+)*([.][.]?)?)|(~[^:/]*)(/[^:]*)?|(~[^:]*)(:.*)?|/+([.][.]?/+)*([^:/]+)(/[^:]*)?|([^:]+):.*)$./:::/\:HOMEvariable to expand pathcouldn't find HOME environment " doesn't existuser "-nocomplain--": must be -nocomplain or --bad switch " ?switches? name ?name ...?"wrong # args: should be "\[]*?{}supported in user namesglobbing characters not "s "no files matched glob pattern "}unmatched open-brace in file nameunmatched close-brace in file name,*[]?\\."expected integer but got "integer value too large to representIOVERFLOWARITHexpected floating-point number but got "yesnotruefalseonoffexpected boolean value but got "malformed bucket chain in Tcl_DeleteHashEntry%d entries in table, %d buckets number of buckets with %d entries: %d number of buckets with %d or more entries: %d average search distance for entry: %.1fv@called Tcl_FindHashEntry on deleted tablecalled Tcl_CreateHashEntry on deleted tableadd add event ?exec?"wrong # args: should be "exec": should be "exec"bad argument "change change newValue ?event?"event event ?event?"-1info info ?count?"%6d keep keep number""illegal keep count "nextid nextid"%dredo redo ?event?"substitute substitute old new ?event?"words words num-num/pat ?event?"redo, substitute, or words": must be add, change, event, info, keep, nextid, bad option "" hasn't occurred yetevent "" is too far in the pastno event matches "" doesn't appear in event" specified non-existent wordsword selector "": should be num-num or patternbad word selector "whilevwaitupvaruplevelupdateunsupported0unsettracetimetellswitchsubststringsplitsetseekscanreturnrenameregsubregexpreadputsprocpidpackagelsortlsearchlreplacelrangelowerllengthlistlinsertlindexlappendjoininterpinfoincrifhistoryglobalgetsformatforeachforflushfileeventfblockedexprevalerroreofcontinueconcatcloseclockcatchcasebreakarrayappendafter": would create a loopcannot define or rename alias "info commandsunset envtclMasterRecordMakeSafe: could not find master recordCreatSlave: could not find master record" not foundinterpreter named "" already exists, cannot createCreateSlave: out of memory while creating a new interpretertclSlaveRecord0tcl_interactiveerrorInfoerrorCodeCreateInterpObject: could not find master record create ?-safe? ?--? ?path?"wrong # args: should be "-safe--": should be -safebad option "interp%dDeleteInterpObject: could not find master record"bad interpreter path " {}" "alias malformed command: should beSlaveAliasHelper: could not find master record alias slavePath slaveCmd masterPath masterCmd ?args ..?"could not find interpreter "DescribeAlias: could not find slave recordDeleteAlias: could not find slave recordalias "DeleteAlias: did not find alias to be deletedTcl_GetInterpPath: could not find master recordGetTarget: could not find master recordGetTarget: could not find slave record" in path "GetTarget: could not find alias record" is not my descendanttarget interpreter for alias " cmd ?arg ...?"Tcl_InterpCmd: could not find master recordaliasaliases aliases ?path?"interpreter "createdeleteexists exists ?path?"1 eval path arg ?arg ...?"issafe issafe ?path?"slaves slaves ?path?"share share srcPath channelId destPath"target target path alias"transfer transfer srcPath channelId destPath"issafe, share, slaves, target or transfer": should be alias, aliases, create, delete, exists, eval, has been deletedinterpreter SlaveObjectCmd: could not find slave record alias aliasName ?targetName? ?args..?SlaveObjectCmd: could not find master record eval arg ?arg ...?" issafe"": should be alias, aliases, eval or issafeSlaveObjectDeleteProc: could not find slave record" for "aliased target "invoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %dSlaveRecordDeleteProc: NULL slavePtrTcl_IsSafe: could not find master recordTcl_GetSlave: could not find master recordTcl_CreateAlias: could not find master recordTcl_GetAlias: could not find slave recordon-blockingtclIOTcl_RegisterChannel: channel without nameTcl_RegisterChannel: duplicate channel namesstdinstdoutstderr"can not find channel named "Tcl_CreateChannel: NULL channel nameTclFlush, closed channel: queued output leftFlushChannel: damaged channel listcalled Tcl_Close on channel with refcount > 0Tcl_Write: AUTO output translation mode not supportedTcl_Write: unknown output translation modeunknown eol translation mode01-bufferinglinenonefull-buffersize%d-eofchar%c-translationautocrcrlflferror setting blocking mode: must be one of full, line, or nonebad value for -buffering: two elementsbad value for -eofchar: should be a list of one orbinaryplatform or platformmust be one of auto, binary, cr, lf, crlf,bad value for -translation: tcp element listbad value for -translation: must be a one or twoor channel type specific option-eofchar, -translation, ": should be -blocking, -buffering, -buffersize, bad option " channelId event ?script?wrong # args: must be "readableactivewritable": must be active, readable, or writablebad event name "channel is not subcommand ?additional args..?"wrong # args: should be "info info channelName"readwritenonblockingblockingasync_flusheofblockedunblockedsaw_crqueued_crinputbufferedchannel name requiredmodenameopenoutputbufferedqueuedcrrefcounttypeinfo, open, readable, or writable": should be channelName cmd ?arg1? ?arg2?"add channelName add eventSpec script"": must be readable or writabledelete channelName delete index": must be nonnegativebad event index: : out of rangebad event index TclTestChannelEventCmd: damaged event script listlist channelName list"removeall channelName removeall"add, delete, list, or removeall, must be one of bad command -nonewline ?-nonewline? ?channelId? string"wrong # args: should be "nonewline": should be "nonewline"bad argument "stdout" wasn't opened for writingchannel " ": error writing " channelId"error flushing " channelId ?varName?"" wasn't opened for readingerror reading "%d ?-nonewline? channelId" channelId ?numBytes?" or " inChanId outChanId ?chunkSize?": channelId offset ?origin?"startcurrentend": should be start, current, or endbad origin "error during seek on " channelId ?optionName? ?value? ?optionName value?..."option retrieval failedor a channel type specific option-eofchar, -translation, ": must be -blocking, -buffering, -buffersize, bad option "-keepnewline--": must be -keepnewline or --bad switch " ?switches? arg ?arg ...?"error reading output from command: fileName ?access? ?permissions?"rTcl_OpenCmd: invalid mode valuetclTCPAcceptCallbacksRegisterTcpServerCleanup: damaged accept record table -servercannot set -async option for server socketsno argument given for -server option-myaddrno argument given for -myaddr option-myportno argument given for -myport optiontcp-async", must be -async, -myaddr, -myport, or -serverOption -myport is not valid for servers -server command ?-myaddr addr? port ?-myaddr addr? ?-myport myport? ?-async? host port wrong # args: should be either: couldn't open socket: port number too highwritingreading" wasn't opened for channel "": file "writereadcouldn't " as last word in commandcan't specify ""illegal access mode " while processing open access modes "RDONLYWRONLYRDWRAPPENDCREATEXCLNOCTTYNONBLOCKTRUNC EXCL, NOCTTY, NONBLOCK, or TRUNC": must be RDONLY, WRONLY, RDWR, APPEND, CREATinvalid access mode " RDONLY, WRONLY, or RDWRaccess mode must include eithercouldn't read file "r (file "%.150s" line %d)child process lost (is SIGCHLD ignored or trapped?)error waiting for process to exit: %dCHILDSTATUSCHILDKILLED child killed: CHILDSUSPchild suspended: child wait status didn't make sense error reading stderr output file: child process exited abnormallyillegal use of | or |& in command notation is not supported on this systemredirection with '@'didn't specify command to executecouldn't create input file for command: couldn't create input pipe for command: couldn't create output pipe for command: couldn't create error file for command: POSIX standard output was redirectedcan't read output from command: standard input was redirectedcan't write input to command:pipe for command could not be createdinternal error: bad linked variable typelinked variable is read-onlyinternal error: linked variable couldn't be readvariable must have integer valuevariable must have real valuevariable must have boolean value%d10NULL?? fileName ?packageName? ?interp?"wrong # args: should be "must specify either file name or package name"couldn't find slave interpreter named "" is already loaded for package "file "tclLoad" isn't loaded staticallypackage "couldn't figure out package name for _Init_SafeInitcouldn't find procedure _SafeInit procedureno can't use package in a safe interpreter: errorInfoerrorCode{} {argv%dargcargv010tcl_interactiveapplication-specific initialization failed: errorInfotcl_rcFileNamerexit %dstdoutstderrtcl_prompt2tcl_prompt1% (script that generates prompt)missing %cmissing close-bracemissing close-bracketextra characters after close-quoteextra characters after close-bracemissing close-brace for variable name$ (parsing index for array "%.*s"), then ": conflicting versions provided for package " ("package ifneeded" script) {} -exact ("package unknown" script)can't find package , need ": have version conflict for package " option ?arg arg ...?"wrong # args: should be "forgetifneeded ifneeded package version ?script?"names names"provide provide package ?version?"require require ?-exact? package ?version?"-exactunknown unknown ?command?"vcompare vcompare version1 version2"%dversions versions package"vsatisfies vsatisfies version1 version2"versions, or vsatisfiesprovide, require, unknown, vcompare, ": should be forget, ifneeded, names, bad option ""expected version number but got "E2BIGEACCESEADDRINUSEEADDRNOTAVAILEADVEAFNOSUPPORTEAGAINEALREADYEBADEEBADFEBADFDEBADMSGEBADREBADRQCEBADSLTEBFONTEBUSYECHILDECHRNGECOMMECONNABORTEDECONNREFUSEDECONNRESETEDESTADDRREQEDOMEDOTDOTEDQUOTEEXISTEFAULTEFBIGEHOSTDOWNEHOSTUNREACHEIDRMEINPROGRESSEINTREINVALEIOEISCONNEISDIREL2HLTEL2NSYNCEL3HLTEL3RSTELIBACCELIBBADELIBEXECELIBMAXELIBSCNELNRNGELOOPEMFILEEMLINKEMSGSIZEEMULTIHOPENAMETOOLONGENAVAILENETDOWNENETRESETENETUNREACHENFILEENOANOENOBUFSENOCSIENODATAENODEVENOENTENOEXECENOLCKENOLINKENOMEMENOMSGENONETENOPKGENOPROTOOPTENOSPCENOSRENOSTRENOSYSENOTBLKENOTCONNENOTDIRENOTEMPTYENOTNAMENOTSOCKENOTTYENOTUNIQENXIOEOPNOTSUPPEPERMEPFNOSUPPORTEPIPEEPROTOEPROTONOSUPPORTEPROTOTYPEERANGEEREMCHGEREMOTEEREMOTEIOEROFSESHUTDOWNESOCKTNOSUPPORTESPIPEESRCHESRMNTESTALEETIMEETIMEDOUTETOOMANYREFSETXTBSYEUCLEANEUNATCHEUSERSEXDEVEXFULLunknown errorargument list too longpermission deniedaddress already in usecan't assign requested addressadvertise erroraddress family not supported by protocol familyresource temporarily unavailableoperation already in progressbad exchange descriptorbad file numberfile descriptor in bad statenot a data messagebad request descriptorbad request codeinvalid slotbad font file formatmount device busyno childrenchannel number out of rangecommunication error on sendsoftware caused connection abortconnection refusedconnection reset by peerdestination address requiredmath argument out of rangecross mount pointdisk quota exceededfile already existsbad address in system call argumentfile too largehost is downhost is unreachableidentifier removedoperation now in progressinterrupted system callinvalid argumentI/O errorsocket is already connectedillegal operation on a directorylevel 2 haltedlevel 2 not synchronizedlevel 3 haltedlevel 3 resetcan not access a needed shared libraryaccessing a corrupted shared librarycan not exec a shared library directlyattempting to link in more shared libraries than system limit.lib section in a.out corruptedlink number out of rangetoo many levels of symbolic linkstoo many open filestoo many linksmessage too longmultihop attemptedfile name too longnot availablenetwork is downnetwork dropped connection on resetnetwork is unreachablefile table overflowanode table overflowno buffer space availableno CSI structure availableno data availableno such deviceno such file or directoryexec format errorno locks availablelink has be severednot enough memoryno message of desired typemachine is not on the networkpackage not installedbad proocol optionno space left on deviceout of stream resourcesnot a stream devicefunction not implementedblock device requiredsocket is not connectednot a directorydirectory not emptynot a name filesocket operation on non-socketinappropriate device for ioctlname not unique on networkno such device or addressoperation not supported on socketnot ownerprotocol family not supportedbroken pipeprotocol errorprotocol not supporedprotocol wrong type for socketmath result unrepresentableremote address changedpathname hit remote file systemremote i/o errorread-only file systemcan't send afer socket shutdownsocket type not supportedinvalid seekno such processsrmount errorstale remote file handletimer expiredconnection timed outtoo many references: can't splicetext file or pseudo-device busystructure needs cleaningprotocol driver not attachedtoo many userscross-domain linkmessage tables fullSIGABRTSIGALRMSIGBUSSIGCHLDSIGCONTSIGFPESIGHUPSIGILLSIGINTSIGIOSIGKILLSIGPIPESIGPROFSIGPWRSIGQUITSIGSEGVSIGSTOPSIGTERMSIGTRAPSIGTSTPSIGTTINSIGTTOUSIGURGSIGUSR1SIGUSR2SIGVTALRMSIGWINCHSIGXCPUSIGXFSZunknown signalalarm clockbus errorchild status changedcontinue after stopfloating-point exceptionhangupillegal instructioninterruptinput/output possible on filekill signalwrite on pipe with no readersprofiling alarmpower-fail restartquit signalsegmentation violationstopsoftware termination signaltrace trapstop signal from ttybackground tty readbackground tty writeurgent I/O conditionuser-defined signal 1user-defined signal 2virtual time alarmwindow changedexceeded CPU time limitexceeded file size limitTcl_Release couldn't find reference for 0x%xTcl_EventuallyFree called twice for 0x%x name args body"wrong # args: should be ""too many fields in argument specifier "" has argument with no nameprocedure "bad level " ?level? command ?arg ...?" ("uplevel" body line %d)args" to "no value given for parameter "" with too many argumentscalled " (procedure "%.50s" line %d)invoked "break" outside of a loopinvoked "continue" outside of a loopNONEerrorCodeerrorInfolist element in braces followed by "%.*s" instead of spaceinstead of spacelist element in quotes followed by "%.*s" %sunmatched open brace in listunmatched open quote in listinternal error in Tcl_SplitListerrorCodeend": must be integer or "end"bad index "couldn't compile regular expression pattern: error while matching regular expression: {{}%g%dimproper value for precision%%.%dgno such variablevariable is arrayvariable isn't arrayno such element in arrayupvar refers to element in deleted arrayreadsetunsettrace varName ?newValue?"wrong # args: should be " varName ?varName ...?" varName ?value value ...?" option arrayName ?arg ...?"anymore anymore arrayName searchId"01donesearch donesearch arrayName searchId"exists exists arrayName"get get arrayName ?pattern?"names names arrayName ?pattern?"nextelement nextelement arrayName searchId" set arrayName list"list must have an even number of elementssize size arrayName"%dstartsearch startsearch arrayName"s-1--s-set, size, or startsearchget, names, nextelement, ": should be anymore, donesearch, exists, bad option "" isn't an array"accesscan't upvar from variable to itself" already existsvariable "" has traces: can't use for upvar ?level? otherVar localVar ?otherVar localVar ...?"illegal search identifier "" isn't for variable "search identifier "couldn't find search " "can't )(": filepipetcp%dpipeErrorTcl_OpenFileChannel: invalid mode value": couldn't open "file%dcouldn't create channel "couldn't seek to end of file on " ?channelId?"wrong # args: should be "%ld-peername-socknamecouldn't open socket: sock%dauto crlf-translationlinenoneTclGetDefaultStdChannel: Unexpected channel typeauto-buffering" wasn't opened for writing"" wasn't opened for readingwrcannot get a FILE * for "" cannot be used to get a FILE * - unsupported type": couldn't change working directory to "working directory name is too longerror getting working directory name: Tcl_CloseFile: unexpected file typeTcl_ReadFile: unexpected file typeTcl_WriteFile: unexpected file typeTcl_SeekFile: unexpected file typePATH:/bin:/usr/bin/.couldn't read directory "Tcl_WatchFile: unexpected file typeTcl_WatchFile can't handle file id %dTcl_FileReady: unexpected file typecouldn't create pipe: %dforked process couldn't set up input/output: %dcouldn't execute "%.150s": couldn't fork child process: tcl_libraryunixplatformtcl_platformososVersionmachine7.5Tclenv/": couldn't load file "__FP10Tcl_Interp #+-*/\()={}[]<>!@$%^~`,?;:|'" 999x9s9W9R9.9)9099p88Р88 ?88 88?w8s8`8\8@8838Д 8879P9p9p9@9\8p38p9`999@{CfC]C`BC;CPCC BBBBBB`rBlBOBIB(B"B`BA0AAAAAAtAlAQAJA>A8AAA@@@@`@@@@p@@@SD =DAа$DJA DAPClACA0CCpCC C"BC@@#LW##W#%R[%n-list|-kick|-wall|-wallop|-msg|-notice|-topic|-kboot|-ansi|-kill|-help%R]%n %Y<%n#|channel|nick%Y> <%nchannel|nick%Y>- Scripting commandi{Vg#c0.#(@0( `  D9.P= ߗ8 0?PP̔Ɣ{P!{!7c[S ٓדy˓Ɠ4y&{ؒВOF00̑Ƒ0gb <9vݐِՐvpj@!d `[ :PNIPJa!x50!c\p 0}͍ƍd d pg^d ?7/d d d nj qkPWMM  gb]Ј݊ՊՊ?vPql]XSP 0XRL0XF@ `zۈֈш?rur=95 ؇=ԇЇ_[W"@نφ ņp `K + cyr1(`zctqnyVRR?  ؄ԄЄ{ _\ !XcMJP"`xsQIDD~!9 @[ : ! ! ROOg`;yu !m !e]$|vp>94 0vݐ`U?y YT !OF+P%~~~`~~~ !~~` /~+~'~` }}}` C}<} 8}4}` |||@)|||0!|u|0!~~`| |P%~|@{{{{P*{!{{{5{!3{puzzvuzpzpz@I:z1z@ yyy H~y|ywyiy\y 7y/y xxwy0Gxxx?mxhxhxSxKxKx< .x+x"xVwwwUwOwP vvvmvv< vvpav[vYv!VvSvy;v4v4v?vv v<uu7 uu ouu`uu`uyuqu`PuMu{uup ttgtt0lttj^tIIJUtLtssdsssV sss??s:s5sY1s v<rrrrr^cr\rUrdqqqpqquqmqP eq `q`q#k:k6k{kk4>kkN ![[ :kjjP>jj0[jUj =j5j-jV jjPiipiii?2i+i`l ihl hhh (!hh (!hh (!hh (!hh (!hh (!hh (!hh (!~hxh (!shnh (!hhbh (!]hXh (!RhLh (!EhpL 0h+h&h (! hh (!h h (!hh (!gg (!gg (!gg (!gg (!gg (!gg (!gg (!gg (!gg (!ggT rgkg` gg ff0 fff?NfGfAfAf?Z4ZI ZZYY!YY= YY !YY0EYYY8 YYcY1\0Y{YtY@ pYjY` eY F+\YG SYC MYMY?DY;YG 7Y/Y 'Y'Y$!YYbYY.Yp!YY@ YY0GX@ XX;XXmXXX !XX.XX-XXWWW@WW-WW-WWWWWWWp WpW0WW-~WxWxWrWrW~kWkWP>fWfW<`W #r@mT OT JT B   0 p  ZpU /0* 0 PypsW`QDpP?1p* P  zttex[ L$:( (PT@Dp|,048}<tljH[LRX=\/`&hd6< %D  H 4 L @ X   $ ( ,  u j$ ^( R BP 6T (   ,  0   8     ~ p b T F 8 *            iІHCP Ї(0&~`a[b>8`1`1LE..RN77nh::|0v!{Џie_("fb ~y@tNeEhbyp{w      @     }    t i ^ S H : )  vkYG:#~gV@.nV=0~rfUI</# uaM4! ~paQ:*lS>&rg[OC6)wiV>+gC"}cG, paRE7 (    ucVF/zo\J9#wcN<(adegikltz.`,:; `$A0BC@DE@F GHIJpKL@M`NOPQpRSTU`VWX`YPZa svA Ac A A A yAU sA05 fAn `A^ YAP QA JA_ CAp @ >Ќ >6 >m >P7 >o >k >q >PM>( >P% >@b >pa >H >> > x>  q> l>` f>@\>CX>S>0 J>`~ D>ph ?>@0 4>0 *> !>@= >$ >d  > >J=} =@F=p! =f =J =! =7 =pr =Pl =P = = =P, = =+ =p =~=0r y=p; q=А h= `= X= M=t H= A=@ := ^ 4=  ,=@& '=% =p ==  ==<E<B <0\ < <P' < <- <`<G < <Z <G<p) <d <  <`4 <Pz< s< m<d<@ ^<P T<0F E<F ;<G 4< K -<& '<P <pD <<  < <p <= ;B ;z ;p| ;h ;P ;{ ;`@ ;* ;P ;P ;` ;F ;? ;5 ; ;I ; ; x; q;0 i; a;pJ Y;` N;0~ I; C;: <;: 0;v FFFFLxLhL_LZLNLFL7L-L#LLLKKKKKK KKKKKwKnKbKXKMKDK;K3K'KKK KJ JJJJJJJJJJJJsJiJdJ_JYJRJMJEJ@J:J5J)JJJ JJIIIIIIIIIIII|IsIbI[IPIBI5I-I$IIIIHHHHHHHHkHXHJH1HHH HGGGGGGGGGGGGG|GvGiG\GHGCG uses the virtual hostname if possible -c joins on startup -b load .bitchxrc or .ircrc after connecting to a server -p default server connection port (usually 6667) -f your terminal uses flow controls (^S/^Q), so BitchX shouldn't -F your terminal doesn't use flow control (default) -d runs BitchX in "dumb" terminal mode -q does not load ~/.ircrc -r file load file as list of servers -n nickname nickname to use -a adds default servers and command line servers to server list -x runs BitchX in "debug" mode -v tells you about the client's version -l loads in place of your .ircrc -L loads in place of your .ircrc and expands $ expandos -B force BitchX to fork and return you to shell   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]~*Np1 ?2 5@# " . 0.  ! $ `8 7 ; `> > > ; 8 [~A t< j A Y" H ' 3% @% % + p*  * . @. @ @8 A ? p7 ``7 P@7 @7 0 7  7 6 6 6 $ P; ; p;  PB r8 b YM I7 7- (  8     `( 0f `  p   ru jp. ]0 P < =P. *0 ,  8 A  8  p? ? ? >  @ `@ @ ~@ lPA ^ = P@= B`= 4= &= =  = >  > @>  - wrE=5-%xph`XPKFA<iklmnpsta.1(1111 11000000000000000ALLNONE+4%4!4***{B@  =@@, 8@H 3@< .@% '@ "@`7 @` @B @@2 @ @+ ?+ ?4 ?5 ?( ?7   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~DpLsL%% O{QQQQQQQQQQ RRRQQ:Y7Y0Yff|fxfmfffRfHf9fX +ffff~ eXeeeeee eeee|etehe_eTeIeAe0e eeeddd ddd d d d dudddUdEd6d &dd dccccccccccpc`c QcGcAc2c(cccbbbb` b b ~ b} ~bfbZbOb>b3b'b bba aaaaaaaaa a wad ma _aUaJa?ax3aX,aaa a} ` ```2`````o`]`L`C`:`2` %`` ``x__ _p _ ___ P~ ______@ l_b_S_C_.__ _ ^p ^^^^^^^^P ^ ~^m^d^V^M^~ A^2^ )^^^^ ] ]]]]]]]]]q]b]Q]C]1] !] ]] \ \ \ \ \ \ \ \ x\ i\ Z\ K\ ?\ -\ \ \ \ [ [ [ [ [[ [ [ [ s[ e[ X[ K[ ?[ 2[ $[ [ [ Z Z Z Z Z Z Z Z Z Z rZ eZ XZ KZ >Z 1Z $Z Z ZY YYYYYY0 YYYYYfY7RY>Y#WHOIS#rr@ 4/   tv  {s ' `   tm0 LyP  ۈy0 yp y NI   y` | `T  0 up  ]O  ` ޅم Kz ~ ?zP  DŽÄ 0 oh @9  p lh  ڂӂ  PJ %[| p @ %! | } z| =40  7}` >} 2} by ~ ~Q} d~y` *~#~ }} }Tcl 1.3gɌ;@Ϛ2Kn@p0pztPm0dp^YPTOE.A`92+P# P oڝѝɝÝ ~*w0.s1m`Eg_0YS0KM0rJDG@J7L,H'p!>?@M =0AE QGCyݜxМC˜JĜ ~ y q h _ XQID:3*% ޽Nٽ`'սн<ɽŽ   `           < x    ,,޾ hھh־ Ҿξ ʾƾ ¾ XX X X         L} .y u q m h \c\` >\  X S NI D@ < 07 020- 0)H <F xD B @ ,> h< : 8 6 X4 2 0 . , L* ( & $ \"     l 0    *.-,0)%$# "!+'&/*(igigigigigigigigig igigigigig ig igigigigigigigigigigigigigigigigig'&%$#"!     ig     :/  ,    , :/    &"% !$ #' ('   xvtrpnljgdb`]ZWTRPNKHFDjlB@P{uqib]VNKFA:5-& ~xkd\VPJ@i ";P` @/usr/local/lib/tcl7.5proc init {} { global tcl_library tcl_version tcl_patchLevel env rename init {} set dirs {} if [info exists env(TCL_LIBRARY)] { lappend dirs $env(TCL_LIBRARY) } lappend dirs [info library] set parentDir [file dirname [file dirname [info nameofexecutable]]] lappend dirs $parentDir/lib/tcl$tcl_version if [string match {*[ab]*} $tcl_patchLevel] { set lib tcl$tcl_patchLevel } else { set lib tcl$tcl_version } lappend dirs [file dirname $parentDir]/$lib/library lappend dirs $parentDir/library foreach i $dirs { set tcl_library $i if ![catch {uplevel #0 source $i/init.tcl}] { return } } set msg "Can't find a usable init.tcl in the following directories: " append msg " $dirs " append msg "This probably means that Tcl wasn't installed properly. " error $msg } init@(#) tclParseCmd.c 1.47 95/12/04 14:26:50'.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~T  p,T v `%PGCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2GCC: (GNU) 2.7.2.301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.hash.dynsym.dynstr.rel.bss.rel.plt.init.plt.text.fini.rodata.data.ctors.dtors.got.dynamic.bss.comment.noteԀ# D) D1Tv9 KPB LKPQP VZQ \p,p bx,x jhh pP%PwX%X~`%`t'ԗp(p p$ 4